KEGG   Homo sapiens (human): 6301Help
Entry
6301              CDS       T01001                                 

Gene name
SARS, SERRS, SERS
Definition
seryl-tRNA synthetase (EC:6.1.1.11)
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    6301 (SARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     6301 (SARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   6301 (SARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    6301 (SARS)
 Prokaryotic Type
    6301 (SARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 514 aa AA seqDB search
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAE
RIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEP
SKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggatctggatttgtttcgggtggataaaggaggggacccagccctcatccga
gagacgcaggagaagcgcttcaaggacccgggactagtggaccagctggtgaaggcagac
agcgagtggcgacgatgtagatttcgggcagacaacttgaacaagctgaagaacctatgc
agcaagacaatcggagagaaaatgaagaaaaaagagccagtgggagatgatgagtctgtc
ccagagaatgtgctgagtttcgatgaccttactgcagacgctttagctaacctgaaagtc
tcacaaatcaaaaaagtccgactcctcattgatgaagccatcctgaagtgtgacgcggag
cggataaagttggaagcagagcggtttgagaacctccgagagattgggaaccttctgcac
ccttctgtacccatcagtaacgatgaggatgtggacaacaaagtagagaggatttggggt
gattgtacagtcaggaagaagtactctcatgtggacctggtggtgatggtagatggcttt
gaaggcgaaaagggggccgtggtggctgggagtcgagggtacttcttgaagggggtcctg
gtgttcctggaacaggctctcatccagtatgcccttcgcaccttgggaagtcggggctac
attcccatttataccccctttttcatgaggaaggaggtcatgcaggaggtggcacagctc
agccagtttgatgaagaactttataaggtgattggcaaaggcagtgaaaagtctgatgac
aactcctatgatgagaagtacctgattgccacctcagagcagcccattgctgccctgcac
cgggatgagtggctccggccggaggacctgcccatcaagtatgctggcctgtctacctgc
ttccgtcaggaggtgggctcccatggccgtgacacccgtggcatcttccgagtccatcag
tttgagaagattgaacagtttgtgtactcatcaccccatgacaacaagtcatgggagatg
tttgaagagatgattaccaccgcagaggagttctaccagtccctggggattccttaccac
attgtgaatattgtctcaggttctttgaatcatgctgccagtaagaagcttgacctggag
gcctggtttccgggctcaggagccttccgtgagttggtctcctgttctaattgcacggat
taccaggctcgccggcttcgaatccgatatgggcaaaccaagaagatgatggacaaggtg
gagtttgtccatatgctcaatgctaccatgtgcgccactacccgtaccatctgcgccatc
ctggagaactaccagacagagaagggcatcactgtgcctgagaaattgaaggagttcatg
ccgccaggactgcaagaactgatcccctttgtgaagcctgcgcccattgagcaggagcca
tcaaagaagcagaagaagcaacatgagggcagcaaaaagaaagcagcagcaagagacgtc
accctagaaaacaggctgcagaacatggaggtcaccgatgcttga

DBGET integrated database retrieval system