KEGG   Homo sapiens (human): 6309Help
Entry
6309              CDS       T01001                                 

Gene name
SC5D, ERG3, S5DES, SC5DL
Definition
(RefSeq) sterol-C5-desaturase
  KO
K00227  
Delta7-sterol 5-desaturase [EC:1.14.19.20]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Disease
H01281  
Lathosterolosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    6309 (SC5D)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.20  Delta7-sterol 5(6)-desaturase
     6309 (SC5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75845(Tdark)
UniProt: 
Position
11q23.3-q24.1
AA seq 299 aa AA seqDB search
MDLVLRVADYYFFTPYVYPATWPEDDIFRQAISLLIVTNVGAYILYFFCATLSYYFVFDH
ALMKHPQFLKNQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
VSIISFLFFTDMFIYWIHRGLHHRLVYKRLHKPHHIWKIPTPFASHAFHPIDGFLQSLPY
HIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRVPQILQPFINGSAHHTDHHMFFDYNY
GQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSHSGNGCKNEKLFNGEFTKTE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgtactccgtgttgcagattactatttttttacaccatacgtgtatccagcc
acatggccagaagatgacatcttccgacaagctattagtcttctgattgtaacaaatgtt
ggtgcttacatcctttatttcttctgtgcaacactgagctattattttgtcttcgatcat
gcattaatgaaacatccacaatttttaaagaatcaagtccgtcgagagattaagtttact
gtccaggcattgccatggataagtattcttactgttgcactgttcttgctggagataaga
ggttacagcaaattacatgatgacctaggagagtttccatatggattgtttgaacttgtc
gttagtataatatctttcctctttttcactgacatgttcatctactggattcacagaggc
cttcatcatagactggtatataagcgcctacataaacctcaccatatttggaagattcct
actccatttgcaagtcatgcttttcaccctattgatggctttcttcagagtctaccttac
catatatacccttttatctttccattacacaaggtggtttatttaagtctgtacatcttg
gttaatatctggacaatttccattcatgacggtgattttcgtgtcccccaaatcttacag
ccatttattaatggctcagctcatcatacagaccaccatatgttctttgactataattat
ggacaatatttcactttgtgggataggattggcggctcattcaaaaatccttcatccttt
gaggggaagggaccgctcagttatgtgaaggagatgacagagggaaagcgcagcagccat
tcaggaaatggctgtaagaatgaaaaattattcaatggagagtttacaaagactgaatag

DBGET integrated database retrieval system