KEGG   Homo sapiens (human): 6318Help
Entry
6318              CDS       T01001                                 

Gene name
SERPINB4, LEUPIN, PI11, SCCA-2, SCCA1, SCCA2
Definition
serpin peptidase inhibitor, clade B (ovalbumin), member 4
Orthology
K13963  
serpin B
Organism
hsa  Homo sapiens (human)
Pathway
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    6318 (SERPINB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.3
AA seq 390 aa AA seqDB search
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFD
QVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYL
DAIKKFYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAI
YFKGQWENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLR
TMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN
EEFCCNHPFLFFIRQNKTNSILFYGRFSSP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaattcactcagtgaagccaacaccaagttcatgttcgatctgttccaacagttcaga
aaatcaaaagagaacaacatcttctattcccctatcagcatcacatcagcattagggatg
gtcctcttaggagccaaagacaacactgcacaacaaattagcaaggttcttcactttgat
caagtcacagagaacaccacagaaaaagctgcaacatatcatgttgataggtcaggaaat
gttcatcaccagtttcaaaagcttctgactgaattcaacaaatccactgatgcatatgag
ctgaagatcgccaacaagctcttcggagaaaagacgtatcaatttttacaggaatattta
gatgccatcaagaaattttaccagaccagtgtggaatctactgattttgcaaatgctcca
gaagaaagtcgaaagaagattaactcctgggtggaaagtcaaacgaatgaaaaaattaaa
aacctatttcctgatgggactattggcaatgatacgacactggttcttgtgaacgcaatc
tatttcaaagggcagtgggagaataaatttaaaaaagaaaacactaaagaggaaaaattt
tggccaaacaagaatacatacaaatctgtacagatgatgaggcaatacaattcctttaat
tttgccttgctggaggatgtacaggccaaggtcctggaaataccatacaaaggcaaagat
ctaagcatgattgtgctgctgccaaatgaaatcgatggtctgcagaagcttgaagagaaa
ctcactgctgagaaattgatggaatggacaagtttgcagaatatgagagagacatgtgtc
gatttacacttacctcggttcaaaatggaagagagctatgacctcaaggacacgttgaga
accatgggaatggtgaatatcttcaatggggatgcagacctctcaggcatgacctggagc
cacggtctctcagtatctaaagtcctacacaaggcctttgtggaggtcactgaggaggga
gtggaagctgcagctgccaccgctgtagtagtagtcgaattatcatctccttcaactaat
gaagagttctgttgtaatcaccctttcctattcttcataaggcaaaataagaccaacagc
atcctcttctatggcagattctcatccccatag

DBGET integrated database retrieval system