KEGG   Homo sapiens (human): 6332Help
Entry
6332              CDS       T01001                                 

Gene name
SCN7A, NaG, Nav2.1, Nav2.2, SCN6A
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 7
  KO
K04839  
voltage-gated sodium channel type VII alpha
Organism
hsa  Homo sapiens (human)
Pathway
Adrenergic signaling in cardiomyocytes
Drug target
Prilocaine [DG:DG00803]: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    6332 (SCN7A)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6332 (SCN7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21-q23
AA seq 1682 aa AA seqDB search
MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEEDLKPTPDLEVGKKLPFIYGNLSQG
MVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFF
QLFILISVLIDCVFMSLTNLPKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPW
NWLDFSVTVFEVIIRYSPLDFIPTLQTARTLRILKIIPLNQGLKSLVGVLIHCLKQLIGV
IILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEG
ERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYH
QILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIEPKFQQTGK
ELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAK
TFLIWNCSPCWLKLKEFVHRIIMAPFTDLFLIICIILNVCFLTLEHYPMSKQTNTLLNIG
NLVFIGIFTAEMIFKIIAMHPYGYFQVGWNIFDSMIVFHGLIELCLANVAGMALLRLFRM
LRIFKLGKYWPTFQILMWSLSNSWVALKDLVLLLFTFIFFSAAFGMKLFGKNYEEFVCHI
DKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNLLV
LYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKTQNVPKDTMDH
VNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIAS
GESDIENLDNKEIQSKSGDGGSKEKIKQSSSSECSTVDIAISEEEEMFYGGERSKHLKNG
CRRGSSLGQISGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQ
RKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTR
EELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFSIMGVDLF
AGRFYECIDPTSGERFPSSEVMNKSRCESLLFNESMLWENAKMNFDNVGNGFLSLLQVAT
FNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHK
IKLGGSNIFITVKQRKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVL
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAWNIFDFM
VVIFSITGLCLPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPKVFHNLMLPLMLSLPAL
LNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDVSNFETFGNSMLCLFQVAIFAGWDGML
DAIFNSKWSDCDPDKINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLN
IASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLI
ALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFKITCEPITTTL
KRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATKEGAYFDKAKEKSPIQS
QI
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atgttggcttcaccagaacctaagggccttgttcccttcactaaagagtcttttgaactt
ataaaacagcatattgctaaaacacataatgaagaccatgaagaagaagacttaaagcca
actcctgatttggaagttggcaaaaagcttccatttatttatggaaacctttctcaagga
atggtgtcagagcccttggaagatgtggacccatattactacaagaaaaaaaatactttc
atagtattaaataaaaatagaacaatcttcagattcaatgcggcttccatcttgtgtaca
ttgtctcctttcaattgtattagaagaacaactatcaaggttttggtacatccctttttc
caactgtttattctaattagtgtcctgattgattgcgtattcatgtccctgactaatttg
ccaaaatggagaccagtattagagaatactttgcttggaatttacacatttgaaatactt
gtaaaactctttgcaagaggtgtctgggcaggatcattttccttcctcggtgatccatgg
aactggctcgatttcagcgtaactgtgtttgaggttattataagatactcacctctggac
ttcattccaacgcttcaaactgcaagaactttgagaattttaaaaattattcctttaaat
caaggtctgaaatcccttgtaggggtcctgatccactgcttgaagcagcttattggtgtc
attatcctaactctgttttttctgagcatattttctctaattgggatggggctcttcatg
ggcaacttgaaacataaatgttttcgatggccccaagagaatgaaaatgaaaccctgcac
aacagaactggaaacccatattatattcgagaaacagaaaacttttattatttggaagga
gaaagatatgctctcctttgtggcaacaggacagatgctggtcagtgtcctgaaggatat
gtgtgtgtaaaagctggcataaatcctgatcaaggcttcacaaattttgacagttttggc
tgggccttatttgccctatttcggttaatggctcaggattaccctgaagtactttatcac
cagatactttatgcttctgggaaggtctacatgatattttttgtggtggtaagttttttg
ttttccttttatatggcaagtttgttcttaggcatacttgccatggcctatgaagaagaa
aagcagagagttggtgaaatatctaagaagattgaaccaaaatttcaacagactggaaaa
gaacttcaagaaggaaatgaaacagatgaggccaagaccatacaaatagaaatgaagaaa
aggtcaccaatttccacagacacatcattggatgtgttggaagatgctactctcagacat
aaggaagaacttgaaaaatccaagaagatatgcccattatactggtataagtttgctaaa
actttcttgatctggaattgttctccctgttggttaaaattgaaagagtttgtccatagg
attataatggcaccatttactgatcttttccttatcatatgcataattttaaacgtatgt
tttctgaccttggagcattatccaatgagtaaacaaactaacactcttctcaacattgga
aacctggttttcattggaattttcacagcagaaatgatttttaaaataattgcaatgcat
ccatatgggtatttccaagtaggttggaacatttttgatagcatgatagtgttccatggt
ttaatagaactttgtctagcaaatgttgcaggaatggctcttcttcgattattcaggatg
ttaagaattttcaagttgggaaagtattggccaacattccagattttgatgtggtctctt
agtaactcatgggtggccctgaaagacttggtcctgttgttgttcacattcatcttcttt
tctgctgcattcggcatgaagctgtttggtaagaattatgaagaatttgtctgccacata
gacaaagactgtcaactcccacgctggcacatgcatgactttttccactccttcctgaat
gtgttccgaattctctgtggagagtgggtagagaccttgtgggactgtatggaggttgca
ggccaatcctggtgtattcctttttacctgatggtcattttaattggaaatttactggta
ctttacctgtttctggcattggtgagctcatttagttcatgcaaggatgtaacagctgaa
gagaataatgaagcaaaaaatctccagcttgcagtggcaagaattaaaaaaggaataaac
tatgtgcttcttaaaatactatgcaaaacacaaaatgtcccaaaggacacaatggaccat
gtaaatgaggtatatgttaaagaagatatttctgaccataccctttctgaattgagcaac
acccaagattttctcaaagataaggaaaaaagcagtggcacagagaaaaacgctactgaa
aatgagagccaatcacttatccccagtcctagtgtctcagaaactgtaccaattgcttca
ggagaatctgatatagaaaatctggataataaggagattcagagtaagtctggtgatgga
ggcagcaaagagaaaataaagcaatctagctcatctgaatgcagtactgttgatattgct
atctctgaagaagaagaaatgttctatggaggtgaaagatcaaagcatctgaaaaatggt
tgcagacgcggatcttcacttggtcaaatcagtggagcatccaagaaaggaaaaatctgg
cagaacatcaggaaaacctgctgcaagattgtagagaacaattggtttaagtgttttatt
gggcttgttactctgctcagcactggcactctggcttttgaagatatatatatggatcag
agaaagacaattaaaattttattagaatatgctgacatgatctttacttatatcttcatt
ctggaaatgcttctaaaatggatggcatatggttttaaggcctatttctctaatggctgg
tacaggctggacttcgtggttgttattgtgttttgtcttagcttaataggcaaaactcgg
gaagaactaaaacctcttatttccatgaaattccttcggcccctcagagttctatctcaa
tttgaaagaatgaaggtggttgtgagagctttgatcaaaacaaccttacccactttgaat
gtgtttcttgtctgcctgatgatctggctgatttttagtatcatgggagtagacttattt
gctggcagattctatgaatgcattgacccaacaagtggagaaaggtttccttcatctgaa
gtcatgaataagagtcggtgtgaaagccttctgtttaacgaatccatgctatgggaaaat
gcaaaaatgaactttgataatgttggaaatggtttcctttctctgcttcaagtagcaaca
tttaatggatggatcactattatgaattcagcaattgattctgttgctgttaatatacag
cctcattttgaagtcaacatctacatgtattgttactttatcaactttattatatttgga
gtatttctccctctgagtatgctgattactgttattattgataatttcaacaagcataaa
ataaagctgggaggctcaaatatctttataacggttaaacagagaaaacagtaccgcagg
ctgaagaagctaatgtatgaggattctcaaagaccagtacctcgcccattaaacaagctc
caaggattcatctttgatgtggtaacaagccaagcttttaatgtcattgttatggttctt
atatgtttccaagcaatagccatgatgatagacactgatgttcagagtctacaaatgtcc
attgctctctactggattaactcaatttttgttatgctatatactatggaatgtatactg
aagctcatcgctttccgttgtttttatttcaccattgcgtggaacatttttgattttatg
gtggttattttctccatcacaggactatgtctgcctatgacagtaggatcctaccttgtg
cctccttcacttgtgcaactgatacttctctcacggatcattcacatgctgcgtcttgga
aaaggaccaaaggtgtttcataatctgatgcttcctttgatgctgtccctcccagcatta
ttgaacatcattcttctcatcttcctggtcatgttcatctatgccgtatttggaatgtat
aattttgcctatgttaaaaaagaagctggaattaatgatgtgtctaattttgaaaccttt
ggcaacagtatgctctgtctttttcaagttgcaatatttgctggttgggatgggatgctt
gatgcaattttcaacagtaaatggtctgactgtgatcctgataaaattaaccctgggact
caagttagaggagattgtgggaacccctctgttgggattttttattttgtcagttatatc
ctcatatcatggctgatcattgtaaatatgtacattgttgttgtcatggagtttttaaat
attgcttctaagaagaaaaacaagaccttgagtgaagatgattttaggaaattctttcag
gtatggaaaaggtttgatcctgataggacccagtacatagactctagcaagctttcagat
tttgcagctgctcttgatcctcctcttttcatggcaaaaccaaacaagggccagctcatt
gctttggacctccccatggctgttggggacagaattcattgcctcgatatcttacttgct
tttacaaagagagttatgggtcaagatgtgaggatggagaaagttgtttcagaaatagaa
tcagggtttttgttagccaacccttttaagatcacatgtgagccaattacgactactttg
aaacgaaaacaagaggcagtttcagcaaccatcattcaacgtgcttataaaaattaccgc
ttgaggcgaaatgacaaaaatacatcagatattcatatgatagatggtgacagagatgtt
catgctactaaagaaggtgcctattttgacaaagctaaggaaaagtcacctattcaaagc
cagatctaa

DBGET integrated database retrieval system