KEGG   Homo sapiens (human): 6338Help
Entry
6338              CDS       T01001                                 

Gene name
SCNN1B, BESC1, ENaCb, ENaCbeta, SCNEB
Definition
(RefSeq) sodium channel epithelial 1 beta subunit
  KO
K04825  
amiloride-sensitive sodium channel subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Aldosterone-regulated sodium reabsorption
Disease
H00242  
Liddle syndrome
H00243  
Hyperkalemic distal renal tubular acidosis (RTA type 4)
H00892  
Bronchiectasis with or without elevated sweat chloride
H01633  
High blood pressure
Drug target
Amiloride [DG:DG00275]: 
Triamterene: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    6338 (SCNN1B)
  Sensory system
   04742 Taste transduction
    6338 (SCNN1B)
Ion channels [BR:hsa04040]
 Epithelial and related channels
  Epithelial sodium channel (SCNN)
   6338 (SCNN1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.2-p12.1
AA seq 640 aa AA seqDB search
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFA
ALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELME
AVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSAS
EKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSY
PGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD
IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSP
CTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERD
QSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEF
GEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN
TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaagaagtacctgctgaagggcctgcatcggctgcagaagggccccggctac
acgtacaaggagctgctggtgtggtactgcgacaacaccaacacccacggccccaagcgc
atcatctgtgaggggcccaagaagaaagccatgtggttcctgctcaccctgctcttcgcc
gccctcgtctgctggcagtggggcatcttcatcaggacctacttgagctgggaggtcagc
gtctccctctccgtaggcttcaagaccatggacttccctgccgtcaccatctgcaatgct
agccccttcaagtattccaaaatcaagcatttgctgaaggacctggatgagctgatggaa
gctgtcctggagagaatcctggctcctgagctaagccatgccaatgccaccaggaacctg
aacttctccatctggaaccacacacccctggtccttattgatgaacggaacccccaccac
cccatggtccttgatctctttggagacaaccacaatggcttaacaagcagctcagcatca
gaaaagatctgtaatgcccacgggtgcaaaatggccatgagactatgtagcctcaacagg
acccagtgtaccttccggaacttcaccagtgctacccaggcattgacagagtggtacatc
ctgcaggccaccaacatctttgcacaggtgccacagcaggagctagtagagatgagctac
cccggcgagcagatgatcctggcctgcctattcggagctgagccctgcaactaccggaac
ttcacgtccatcttctaccctcactatggcaactgttacatcttcaactggggcatgaca
gagaaggcacttccttcggccaaccctggaactgaattcggcctgaagttgatcctggac
ataggccaggaagactacgtccccttccttgcgtccacggccggggtcaggctgatgctt
cacgagcagaggtcataccccttcatcagagatgagggcatctacgccatgtcggggaca
gagacgtccatcggggtactcgtggacaagcttcagcgcatgggggagccctacagcccg
tgcaccgtgaatggttctgaggtccccgtccaaaacttctacagtgactacaacacgacc
tactccatccaggcctgtcttcgctcctgcttccaagaccacatgatccgtaactgcaac
tgtggccactacctgtacccactgccccgtggggagaaatactgcaacaaccgggacttc
ccagactgggcccattgctactcagatctacagatgagcgtggcgcagagagagacctgc
attggcatgtgcaaggagtcctgcaatgacacccagtacaagatgaccatctccatggct
gactggccttctgaggcctccgaggactggattttccacgtcttgtctcaggagcgggac
caaagcaccaatatcaccctgagcaggaagggaattgtcaagctcaacatctacttccaa
gaatttaactatcgcaccattgaagaatcagcagccaataacatcgtctggctgctctcg
aatctgggtggccagtttggcttctggatggggggctctgtgctgtgcctcatcgagttt
ggggagatcatcatcgactttgtgtggatcaccatcatcaagctggtggccttggccaag
agcctacggcagcggcgagcccaagccagctacgctggcccaccgcccaccgtggccgag
ctggtggaggcccacaccaactttggcttccagcctgacacggccccccgcagccccaac
actgggccctaccccagtgagcaggccctgcccatcccaggcaccccgccccccaactat
gactccctgcgtctgcagccgctggacgtcatcgagtctgacagtgagggtgatgccatc
taa

DBGET integrated database retrieval system