KEGG   Homo sapiens (human): 6342Help
Entry
6342              CDS       T01001                                 

Gene name
SCP2, NLTP, NSL-TP, SCP-2, SCP-CHI, SCP-X, SCPX
Definition
sterol carrier protein 2 (EC:2.3.1.176)
Orthology
K08764  
sterol carrier protein 2 [EC:2.3.1.176]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Peroxisome
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00407  
Peroxisomal beta-oxidation enzyme deficiency
H00874  
Leukoencephalopathy with dystonia and motor neuropathy
Class
Metabolism; Lipid metabolism; Primary bile acid biosynthesis [PATH:hsa00120]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32
AA seq 322 aa AA seqDB search
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQA
CVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFG
YAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQC
CPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEA
ARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVI
NPSGGLISKGHPLGATGGHSCS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttccccgtgggagcctgcgaccctgcgccgggtgttcgtggtgggggttggc
atgaccaagtttgtgaagcctggagctgagaattcaagagactaccctgacttggcagaa
gaagcaggcaagaaggctttagctgatgcacagatcccttattcagcagtggaccaggca
tgtgttggctatgtttttggtgtggcagaatgtgtcttggctcttgggtttgagaagatg
agtaagggaagccttggaataaaattttcagatagaaccattcccactgataagcatgtt
gacctcctgatcaataagtatggattgtctgctcacccagttgctcctcagatgtttggg
tatgctggaaaagaacatatggaaaaatatggaacaaaaattgaacactttgcaaaaatt
ggatggaaaaatcataaacattcagttaataacccgtattcccagttccaagatgaatac
agtttagatgaagtgatggcatctaaagaagtttttgattttttgactatcttacaatgt
tgtcccacttcagatggtgctgcagcagcaattttggccagtgaagcatttgtacagaag
tatggcctgcaatccaaagctgtggaaattttggcacaagaaatgatgactgatttgcca
agctcgtttgaagaaaaaagcattattaaaatggttggctttgatatgagtaaagaagct
gcaagaaaatgctatgagaaatctggcctgacaccaaatgatattgacgtaatagaactt
cacgattgcttttctaccaacgaactccttacttatgaagcactgggactctgtccagaa
ggacaaggtgcaacgctggttgatagaggagataatacatatggaggaaagtgggtcata
aatcctagtggtggactgatttcaaagggacacccactaggcgctacaggaggacattcc
tgctcttga

DBGET integrated database retrieval system