KEGG   Homo sapiens (human): 6342Help
Entry
6342              CDS       T01001                                 

Gene name
SCP2, NLTP, NSL-TP, SCP-2, SCP-CHI, SCP-X, SCPX
Definition
(RefSeq) sterol carrier protein 2
  KO
K08764  sterol carrier protein 2 [EC:2.3.1.176]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00407  Peroxisomal beta-oxidation enzyme deficiency
H00874  Leukoencephalopathy with dystonia and motor neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    6342 (SCP2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    6342 (SCP2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    6342 (SCP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.176  propanoyl-CoA C-acyltransferase
     6342 (SCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCP2 Thiolase_N Thiolase_C Alkyl_sulf_C ACP_syn_III Ketoacyl-synt_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-GeneID: 6342
NCBI-ProteinID: NP_002970
OMIM: 184755
HGNC: 10606
Ensembl: ENSG00000116171
Vega: OTTHUMG00000008936
Pharos: P22307(Tchem)
UniProt: P22307 B2R761 Q59HG9
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 547 aa AA seqDB search
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQA
CVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALG
FEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEH
FAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEA
FVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDID
VIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKN
GKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQL
QPGNAKL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttccccgtgggagcctgcgaccctgcgccgggtgttcgtggtgggggttggc
atgaccaagtttgtgaagcctggagctgagaattcaagagactaccctgacttggcagaa
gaagcaggcaagaaggctttagctgatgcacagatcccttattcagcagtggaccaggca
tgtgttggctatgtttttggtgactctacctgtgggcagagggctatctatcacagtttg
ggaatgactggaattcctataatcaatgtcaacaataactgtgctactggttctactgct
ttgtttatggcccgccagctgattcagggtggtgtggcagaatgtgtcttggctcttggg
tttgagaagatgagtaagggaagccttggaataaaattttcagatagaaccattcccact
gataagcatgttgacctcctgatcaataagtatggattgtctgctcacccagttgctcct
cagatgtttgggtatgctggaaaagaacatatggaaaaatatggaacaaaaattgaacac
tttgcaaaaattggatggaaaaatcataaacattcagttaataacccgtattcccagttc
caagatgaatacagtttagatgaagtgatggcatctaaagaagtttttgattttttgact
atcttacaatgttgtcccacttcagatggtgctgcagcagcaattttggccagtgaagca
tttgtacagaagtatggcctgcaatccaaagctgtggaaattttggcacaagaaatgatg
actgatttgccaagctcgtttgaagaaaaaagcattattaaaatggttggctttgatatg
agtaaagaagctgcaagaaaatgctatgagaaatctggcctgacaccaaatgatattgac
gtaatagaacttcacgattgcttttctaccaacgaactccttacttatgaagcactggga
ctctgtccagaaggacaaggtgcaacgctggttgatagaggagataatacatatggagga
aagtgggtcataaatcctagtggtggactgatttcaaagggacacccactaggcgctaca
ggtcttgctcagtgtgcagaactctgctggcagctgagaggggaagccggaaagaggcaa
gttcctggtgcaaaggtggctctgcagcataatttaggcattggaggagctgtggttgta
acactctacaagatgggttttccggaagccgccagttcttttagaactcatcaaattgaa
gctgttccaaccagctctgcaagtgatggatttaaggcaaatcttgtttttaaggagatt
gagaagaaacttgaagaggaaggggaacagtttgtgaagaaaatcggtggtatttttgcc
ttcaaggtgaaagatggccctgggggtaaagaggccacctgggtggtggatgtgaagaat
ggcaaaggatcagtgcttcctaactcagataagaaggctgactgcacaatcacaatggct
gactcagacttcctggctttaatgactggtaaaatgaatcctcagtcggccttctttcaa
ggcaaattgaaaatcactggcaacatgggtctcgctatgaagttacaaaatcttcagctt
cagccaggcaacgctaagctctga

DBGET integrated database retrieval system