KEGG   Homo sapiens (human): 6357Help
Entry
6357              CDS       T01001                                 

Gene name
CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1
Definition
chemokine (C-C motif) ligand 13
Orthology
K16595  
C-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    6357 (CCL13)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6357 (CCL13)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6357 (CCL13)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  6357 (CCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 98 aa AA seqDB search
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctctgcagtgcttctgtgcctgctgctcatgacagcagctttcaacccccag
ggacttgctcagccagatgcactcaacgtcccatctacttgctgcttcacatttagcagt
aagaagatctccttgcagaggctgaagagctatgtgatcaccaccagcaggtgtccccag
aaggctgtcatcttcagaaccaaactgggcaaggagatctgtgctgacccaaaggagaag
tgggtccagaattatatgaaacacctgggccggaaagctcacaccctgaagacttga

DBGET integrated database retrieval system