KEGG   Homo sapiens (human): 6360Help
Entry
6360              CDS       T01001                                 

Gene name
CCL16, CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4
Definition
chemokine (C-C motif) ligand 16
Orthology
K05514  
C-C motif chemokine, other
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 120 aa AA seqDB search
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNC
HLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgaggctgccctgtctctccttgtcctcatccttatcattacttcggct
tctcgcagccagccaaaagttcctgagtgggtgaacaccccatccacctgctgcctgaag
tattatgagaaagtgttgccaaggagactagtggtgggatacagaaaggccctcaactgt
cacctgccagcaatcatcttcgtcaccaagaggaaccgagaagtctgcaccaaccccaat
gacgactgggtccaagagtacatcaaggatcccaacctacctttgctgcctaccaggaac
ttgtccacggttaaaattattacagcaaagaatggtcaaccccagctcctcaactcccag
tga

DBGET integrated database retrieval system