KEGG   Homo sapiens (human): 6360Help
Entry
6360              CDS       T01001                                 

Gene name
CCL16, CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4
Definition
(RefSeq) C-C motif chemokine ligand 16
  KO
K21093  C-C motif chemokine 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6360 (CCL16)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6360 (CCL16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6360 (CCL16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6360
NCBI-ProteinID: NP_004581
OMIM: 601394
HGNC: 10614
Ensembl: ENSG00000275152
Vega: OTTHUMG00000188402
Pharos: O15467(Tbio)
UniProt: O15467
Structure
PDB: 

Jmol
Position
17q12
AA seq 120 aa AA seqDB search
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNC
HLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgaggctgccctgtctctccttgtcctcatccttatcattacttcggct
tctcgcagccagccaaaagttcctgagtgggtgaacaccccatccacctgctgcctgaag
tattatgagaaagtgttgccaaggagactagtggtgggatacagaaaggccctcaactgt
cacctgccagcaatcatcttcgtcaccaagaggaaccgagaagtctgcaccaaccccaat
gacgactgggtccaagagtacatcaaggatcccaacctacctttgctgcctaccaggaac
ttgtccacggttaaaattattacagcaaagaatggtcaaccccagctcctcaactcccag
tga

DBGET integrated database retrieval system