KEGG   Homo sapiens (human): 6361Help
Entry
6361              CDS       T01001                                 

Gene name
CCL17, A-152E5.3, ABCD-2, SCYA17, TARC
Definition
(RefSeq) C-C motif chemokine ligand 17
  KO
K21083  C-C motif chemokine 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6361 (CCL17)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    6361 (CCL17)
   04657 IL-17 signaling pathway
    6361 (CCL17)
   04062 Chemokine signaling pathway
    6361 (CCL17)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6361 (CCL17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6361
NCBI-ProteinID: NP_002978
OMIM: 601520
HGNC: 10615
Ensembl: ENSG00000102970
Vega: OTTHUMG00000133468
Pharos: Q92583(Tbio)
UniProt: Q92583
Structure
PDB: 

Jmol
Position
16q21
AA seq 94 aa AA seqDB search
MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggccccactgaagatgctggccctggtcaccctcctcctgggggcttctctgcagcac
atccacgcagctcgagggaccaatgtgggccgggagtgctgcctggagtacttcaaggga
gccattccccttagaaagctgaagacgtggtaccagacatctgaggactgctccagggat
gccatcgtttttgtaactgtgcagggcagggccatctgttcggaccccaacaacaagaga
gtgaagaatgcagttaaatacctgcaaagccttgagaggtcttga

DBGET integrated database retrieval system