KEGG   Homo sapiens (human): 6362Help
Entry
6362              CDS       T01001                                 

Gene name
CCL18, AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
Definition
chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
Orthology
K05514  
C-C motif chemokine, other
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6362 (CCL18)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6362 (CCL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
17q11.2
AA seq 89 aa AA seqDB search
MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI
LLTKRGRQICADPNKKWVQKYISDLKLNA
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaagggccttgcagctgccctccttgtcctcgtctgcaccatggccctctgctcctgt
gcacaagttggtaccaacaaagagctctgctgcctcgtctatacctcctggcagattcca
caaaagttcatagttgactattctgaaaccagcccccagtgccccaagccaggtgtcatc
ctcctaaccaagagaggccggcagatctgtgctgaccccaataagaagtgggtccagaaa
tacatcagcgacctgaagctgaatgcctga

DBGET integrated database retrieval system