KEGG   Homo sapiens (human): 6363Help
Entry
6363              CDS       T01001                                 

Gene name
CCL19, CKb11, ELC, MIP-3b, MIP3B, SCYA19
Definition
chemokine (C-C motif) ligand 19
Orthology
K05512  
C-C motif chemokine 19
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    6363 (CCL19)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6363 (CCL19)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6363 (CCL19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13
AA seq 98 aa AA seqDB search
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctactggccctcagcctgctggttctctggacttccccagccccaactctg
agtggcaccaatgatgctgaagactgctgcctgtctgtgacccagaaacccatccctggg
tacatcgtgaggaacttccactaccttctcatcaaggatggctgcagggtgcctgctgta
gtgttcaccacactgaggggccgccagctctgtgcacccccagaccagccctgggtagaa
cgcatcatccagagactgcagaggacctcagccaagatgaagcgccgcagcagttaa

DBGET integrated database retrieval system