KEGG   Homo sapiens (human): 6370Help
Entry
6370              CDS       T01001                                 

Gene name
CCL25, Ckb15, SCYA25, TECK
Definition
(RefSeq) C-C motif chemokine ligand 25
  KO
K13072  C-C motif chemokine 25
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6370 (CCL25)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    6370 (CCL25)
   04062 Chemokine signaling pathway
    6370 (CCL25)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6370 (CCL25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6370
NCBI-ProteinID: NP_005615
OMIM: 602565
HGNC: 10624
Ensembl: ENSG00000131142
Vega: OTTHUMG00000141287
Pharos: O15444(Tbio)
UniProt: O15444
Position
19p13.2
AA seq 150 aa AA seqDB search
MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNL
PAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSG
NSKLSSSKFSNPISSSKRNVSLLISANSGL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtggctcctggcctgcctggtggccggcttcctgggagcctgggcccccgct
gtccacacccaaggtgtctttgaggactgctgcctggcctaccactaccccattgggtgg
gctgtgctccggcgcgcctggacttaccggatccaggaggtgagcgggagctgcaatctg
cctgctgcgatattctacctccccaagagacacaggaaggtgtgtgggaaccccaaaagc
agggaggtgcagagagccatgaagctcctggatgctcgaaataaggtttttgcaaagctc
caccacaacacgcagaccttccaagcaggccctcatgctgtaaagaagttgagttctgga
aactccaagttatcatcgtccaagtttagcaatcccatcagcagcagtaagaggaatgtc
tccctcctgatatcagctaattcaggactgtga

DBGET integrated database retrieval system