KEGG   Homo sapiens (human): 6370Help
Entry
6370              CDS       T01001                                 

Gene name
CCL25, Ckb15, SCYA25, TECK
Definition
chemokine (C-C motif) ligand 25
Orthology
K13072  
C-C motif chemokine 25
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6370 (CCL25)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    6370 (CCL25)
   04062 Chemokine signaling pathway
    6370 (CCL25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 149 aa AA seqDB search
MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNL
PAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQGPHAVKKLSSGN
SKLSSSKFSNPISSSKRNVSLLISANSGL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtggctcctggcctgcctggtggccggcttcctgggagcctgggcccccgct
gtccacacccaaggtgtctttgaggactgctgcctggcctaccactaccccattgggtgg
gctgtgctccggcgcgcctggacttaccggatccaggaggtgagcgggagctgcaatctg
cctgctgcgatattctacctccccaagagacacaggaaggtgtgtgggaaccccaaaagc
agggaggtgcagagagccatgaagctcctggatgctcgaaataaggtttttgcaaagctc
caccacaacacgcagaccttccaaggccctcatgctgtaaagaagttgagttctggaaac
tccaagttatcatcgtccaagtttagcaatcccatcagcagcagtaagaggaatgtctcc
ctcctgatatcagctaattcaggactgtga

DBGET integrated database retrieval system