KEGG   Homo sapiens (human): 6372Help
Entry
6372              CDS       T01001                                 

Gene name
CXCL6, CKA-3, GCP-2, GCP2, SCYB6
Definition
chemokine (C-X-C motif) ligand 6
Orthology
K05506  
C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Pertussis
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6372 (CXCL6)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6372 (CXCL6)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6372 (CXCL6)
  Infectious diseases
   05133 Pertussis
    6372 (CXCL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13.3
AA seq 114 aa AA seqDB search
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcccgtccagccgcgcggcccgtgtcccgggtccttcgggctccttgtgcgcg
ctgctcgcgctgctgctcctgctgacgccgccggggcccctcgccagcgctggtcctgtc
tctgctgtgctgacagagctgcgttgcacttgtttacgcgttacgctgagagtaaacccc
aaaacgattggtaaactgcaggtgttccccgcaggcccgcagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaagcaagtttgtctggacccggaagccccttttctaaag
aaagtcatccagaaaattttggacagtggaaacaagaaaaactga

DBGET integrated database retrieval system