KEGG   Homo sapiens (human): 6372Help
Entry
6372              CDS       T01001                                 

Gene name
CXCL6, CKA-3, GCP-2, GCP2, SCYB6
Definition
(RefSeq) C-X-C motif chemokine ligand 6
  KO
K05506  
C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
IL-17 signaling pathway
Pertussis
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6372 (CXCL6)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    6372 (CXCL6)
   04062 Chemokine signaling pathway
    6372 (CXCL6)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6372 (CXCL6)
  Infectious diseases
   05133 Pertussis
    6372 (CXCL6)
Cytokines [BR:hsa04052]
 Chemokines
  CXC chemokine family
   6372 (CXCL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P80162(Tbio)
UniProt: 
Position
4q13.3
AA seq 114 aa AA seqDB search
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcccgtccagccgcgcggcccgtgtcccgggtccttcgggctccttgtgcgcg
ctgctcgcgctgctgctcctgctgacgccgccggggcccctcgccagcgctggtcctgtc
tctgctgtgctgacagagctgcgttgcacttgtttacgcgttacgctgagagtaaacccc
aaaacgattggtaaactgcaggtgttccccgcaggcccgcagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaagcaagtttgtctggacccggaagccccttttctaaag
aaagtcatccagaaaattttggacagtggaaacaagaaaaactga

DBGET integrated database retrieval system