KEGG   Homo sapiens (human): 6374Help
Entry
6374              CDS       T01001                                 

Gene name
CXCL5, ENA-78, SCYB5
Definition
chemokine (C-X-C motif) ligand 5
Orthology
K05506  
C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
TNF signaling pathway
Pertussis
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6374 (CXCL5)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6374 (CXCL5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6374 (CXCL5)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6374 (CXCL5)
  Infectious diseases
   05133 Pertussis
    6374 (CXCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13.3
AA seq 114 aa AA seqDB search
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg
ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc
gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc
aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag
aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

DBGET integrated database retrieval system