KEGG   Homo sapiens (human): 6374Help
Entry
6374              CDS       T01001                                 

Gene name
CXCL5, ENA-78, SCYB5
Definition
chemokine (C-X-C motif) ligand 5
Orthology
K05506  
C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
TNF signaling pathway
Pertussis
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13.3
AA seq 114 aa AA seqDB search
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg
ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc
gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc
aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag
aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

DBGET integrated database retrieval system