KEGG   Homo sapiens (human): 6386Help
Entry
6386              CDS       T01001                                 

Gene name
SDCBP, MDA-9, MDA9, ST1, SYCL, TACIP18
Definition
(RefSeq) syndecan binding protein
  KO
K17254  
syntenin-1
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   6386 (SDCBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q12
AA seq 298 aa AA seqDB search
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLS
LNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKD
QDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ
AFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICE
INGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctatccatctctcgaagacttgaaggtagacaaagtaattcaggctcaaact
gctttttctgcaaaccctgccaatccagcaattttgtcagaagcttctgctcctatccct
cacgatggaaatctctatcccagactgtatccagagctctctcaatacatggggctgagt
ttaaatgaagaagaaatacgtgcaaatgtggccgtggtttctggtgcaccacttcagggg
cagttggtagcaagaccttccagtataaactatatggtggctcctgtaactggtaatgat
gttggaattcgtagagcagaaattaagcaagggattcgtgaagtcattttgtgtaaggat
caagatggaaaaattggactcaggcttaaatcaatagataatggtatatttgttcagcta
gtccaggctaattctccagcctcattggttggtctgagatttggggaccaagtacttcag
atcaatggtgaaaactgtgcaggatggagctctgataaagcgcacaaggtgctcaaacag
gcttttggagagaagattaccatgaccattcgtgacaggccctttgaacggacgattacc
atgcataaggatagcactggacatgttggttttatctttaaaaatggaaaaataacatcc
atagtgaaagatagctctgcagccagaaatggtcttctcacggaacataacatctgtgaa
atcaatggacagaatgtcattggattgaaggactctcaaattgcagacatactgtcaaca
tctgggactgtagttactattacaatcatgcctgcttttatctttgaacatattattaag
cggatggcaccaagcattatgaaaagcctaatggaccacaccattcctgaggtttaa

DBGET integrated database retrieval system