KEGG   Homo sapiens (human): 6389Help
Entry
6389              CDS       T01001                                 

Gene name
SDHA, CMD1GG, FP, PGL5, SDH1, SDH2, SDHF
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Disease
H00294  Dilated cardiomyopathy (DCM)
H01022  Diseases of the tricarboxylic acid cycle
H01354  Leigh syndrome
H02005  Mitochondrial complex II deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6389 (SDHA)
  Energy metabolism
   00190 Oxidative phosphorylation
    6389 (SDHA)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    6389 (SDHA)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6389 (SDHA)
   05012 Parkinson's disease
    6389 (SDHA)
   05016 Huntington's disease
    6389 (SDHA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6389 (SDHA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6389 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 6389
NCBI-ProteinID: NP_004159
OMIM: 600857
HGNC: 10680
Ensembl: ENSG00000073578
Vega: OTTHUMG00000090275
Pharos: P31040(Tbio)
UniProt: P31040 A0A024QZ30
Position
5p15.33
AA seq 664 aa AA seqDB search
MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggggcctgtcgcggctgctgagcgctcggcgcctggcgctggccaag
gcgtggccaacagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttaccaagctgtttcctaccaggtcacacact
gttgcagcacagggaggaatcaatgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacggagcaggcccccgccgccgtggtcgagctagaaaattatggcatgccgttt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggactggccactcgcta
ttgcacaccttatatggaaggtctctgcgatatgataccagctattttgtggagtatttt
gccttggatctcctgatggagaatggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccatccatcgcataagagcaaagaacactgttgttgccacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcactggcgacggcacggccatgatc
accagggcaggccttccttgccaggacctagagtttgttcagttccaccctacaggcata
tatggtgctggttgtctcattacggaaggatgtcgtggagagggaggcattctcattaac
agtcaaggcgaaaggtttatggagcgatacgcccctgtcgcgaaggacctggcgtctaga
gatgtggtgtctcggtccatgactctggagatccgagaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctacctccagagcagctggccacgcgcctg
cctggcatttcagagacagccatgatcttcgctggcgtggacgtcacgaaggagccgatc
cctgtcctccccaccgtgcattataacatgggcggcattcccaccaactacaaggggcag
gtcctgaggcacgtgaatggccaggatcagattgtgcccggcctgtacgcctgtggggag
gccgcctgtgcctcggtacatggtgccaaccgcctcggggcaaactcgctcttggacctg
gttgtctttggtcgggcatgtgccctgagcatcgaagagtcatgcaggcctggagataaa
gtccctccaattaaaccaaacgctggggaagaatctgtcatgaatcttgacaaattgaga
tttgctgatggaagcataagaacatcggaactgcgactcagcatgcagaagtcaatgcaa
aatcatgctgccgtgttccgtgtgggaagcgtgttgcaagaaggttgtgggaaaatcagc
aagctctatggagacctaaagcacctgaagacgttcgaccggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcacggaaggagtcacggggcgcgcatgccagggaagactacaaggtgcgg
attgatgagtacgattactccaagcccatccaggggcaacagaagaagccctttgaggag
cactggaggaagcacaccctgtcctatgtggacgttggcactgggaaggtcactctggaa
tatagacccgtgatcgacaaaactttgaacgaggctgactgtgccaccgtcccgccagcc
attcgctcctactga

DBGET integrated database retrieval system