KEGG   Homo sapiens (human): 6389Help
Entry
6389              CDS       T01001                                 

Gene name
SDHA, CMD1GG, FP, PGL5, SDH1, SDH2, SDHF
Definition
succinate dehydrogenase complex, subunit A, flavoprotein (Fp) (EC:1.3.5.1)
Orthology
K00234  
succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Disease
H00294  
Dilated cardiomyopathy (DCM)
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01022  
Diseases of the tricarboxylic acid cycle
H01354  
Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    6389 (SDHA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6389 (SDHA)
  Energy metabolism
   00190 Oxidative phosphorylation
    6389 (SDHA)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6389 (SDHA)
   05012 Parkinson's disease
    6389 (SDHA)
   05016 Huntington's disease
    6389 (SDHA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6389 (SDHA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6389 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15
AA seq 616 aa AA seqDB search
MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQLENYGMPFSRTEDGKI
YQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEN
GECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQ
DLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMT
LEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHY
NMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACA
LSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRV
GSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKES
RGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKT
LNEADCATVPPAIRSY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggggcctgtcgcggctgctgagcgctcggcgcctggcgctggccaag
gcgtggccaacagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttaccaagctgtttcctaccaggtcacacact
gttgcagcacagctagaaaattatggcatgccgtttagcagaactgaagatgggaagatt
tatcagcgtgcatttggtggacagagcctcaagtttggaaagggcgggcaggcccatcgg
tgctgctgtgtggctgatcggactggccactcgctattgcacaccttatatggaaggtct
ctgcgatatgataccagctattttgtggagtattttgccttggatctcctgatggagaat
ggggagtgccgtggtgtcatcgcactgtgcatagaggacgggtccatccatcgcataaga
gcaaagaacactgttgttgccacaggaggctacgggcgcacctacttcagctgcacgtct
gcccacaccagcactggcgacggcacggccatgatcaccagggcaggccttccttgccag
gacctagagtttgttcagttccaccctacaggcatatatggtgctggttgtctcattacg
gaaggatgtcgtggagagggaggcattctcattaacagtcaaggcgaaaggtttatggag
cgatacgcccctgtcgcgaaggacctggcgtctagagatgtggtgtctcggtccatgact
ctggagatccgagaaggaagaggctgtggccctgagaaagatcacgtctacctgcagctg
caccacctacctccagagcagctggccacgcgcctgcctggcatttcagagacagccatg
atcttcgctggcgtggacgtcacgaaggagccgatccctgtcctccccaccgtgcattat
aacatgggcggcattcccaccaactacaaggggcaggtcctgaggcacgtgaatggccag
gatcagattgtgcccggcctgtacgcctgtggggaggccgcctgtgcctcggtacatggt
gccaaccgcctcggggcaaactcgctcttggacctggttgtctttggtcgggcatgtgcc
ctgagcatcgaagagtcatgcaggcctggagataaagtccctccaattaaaccaaacgct
ggggaagaatctgtcatgaatcttgacaaattgagatttgctgatggaagcataagaaca
tcggaactgcgactcagcatgcagaagtcaatgcaaaatcatgctgccgtgttccgtgtg
ggaagcgtgttgcaagaaggttgtgggaaaatcagcaagctctatggagacctaaagcac
ctgaagacgttcgaccggggaatggtctggaacacggacctggtggagaccctggagctg
cagaacctgatgctgtgtgcgctgcagaccatctacggagcagaggcacggaaggagtca
cggggcgcgcatgccagggaagactacaaggtgcggattgatgagtacgattactccaag
cccatccaggggcaacagaagaagccctttgaggagcactggaggaagcacaccctgtcc
tatgtggacgttggcactgggaaggtcactctggaatatagacccgtgatcgacaaaact
ttgaacgaggctgactgtgccaccgtcccgccagccattcgctcctactga

DBGET integrated database retrieval system