KEGG   Homo sapiens (human): 6392Help
Entry
6392              CDS       T01001                                 

Gene name
SDHD, CBT1, CII-4, CWS3, PGL, PGL1, QPs3, SDH4, cybS
Definition
succinate dehydrogenase complex, subunit D, integral membrane protein
Orthology
K00237  
succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Disease
H00034  
Carcinoid
H01222  
Cowden-like syndrome
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23
AA seq 85 aa AA seqDB search
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHWALD
KLLLTMFMGMPCRKLPRQGFWHFQL
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctctggaggctgagtgccgtttgcggtgccctaggaggccgagctctgttg
cttcgaactccagtggtcagacctgctcatatctcagcatttcttcaggaccgacctatc
ccagaatggtgtggagtgcagcacatacacttgtcaccgagccaccattgggccttggac
aagttgttactgactatgttcatggggatgccttgcagaaagctgccaaggcagggcttt
tggcactttcagctttaa

DBGET integrated database retrieval system