KEGG   Homo sapiens (human): 6392Help
Entry
6392              CDS       T01001                                 

Gene name
SDHD, CBT1, CII-4, CWS3, PGL, PGL1, QPs3, SDH4, cybS
Definition
(RefSeq) succinate dehydrogenase complex subunit D
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Disease
H00034  Carcinoid
H01222  Cowden syndrome
H01510  Malignant paraganglioma
H02005  Mitochondrial complex II deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6392 (SDHD)
  Energy metabolism
   00190 Oxidative phosphorylation
    6392 (SDHD)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    6392 (SDHD)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6392 (SDHD)
   05012 Parkinson's disease
    6392 (SDHD)
   05016 Huntington's disease
    6392 (SDHD)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6392 (SDHD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CybS Ldh_2
Motif
Other DBs
NCBI-GeneID: 6392
NCBI-ProteinID: NP_002993
OMIM: 602690
HGNC: 10683
Ensembl: ENSG00000204370
Vega: OTTHUMG00000166997
Pharos: O14521(Tbio)
UniProt: O14521 A0A0S2Z4J3
Position
11q23.1
AA seq 159 aa AA seqDB search
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSK
AASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL
QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctctggaggctgagtgccgtttgcggtgccctaggaggccgagctctgttg
cttcgaactccagtggtcagacctgctcatatctcagcatttcttcaggaccgacctatc
ccagaatggtgtggagtgcagcacatacacttgtcaccgagccaccattctggctccaag
gctgcatctctccactggactagcgagagggttgtcagtgttttgctcctgggtctgctt
ccggctgcttatttgaatccttgctctgcgatggactattccctggctgcagccctcact
cttcatggtcactggggccttggacaagttgttactgactatgttcatggggatgccttg
cagaaagctgccaaggcagggcttttggcactttcagctttaacctttgctgggctttgc
tatttcaactatcacgatgtgggcatctgcaaagctgttgccatgctgtggaagctctga

DBGET integrated database retrieval system