KEGG   Homo sapiens (human): 63928Help
Entry
63928             CDS       T01001                                 

Gene name
CHP2
Definition
(RefSeq) calcineurin like EF-hand protein 2
  KO
K17611  calcineurin B homologous protein 2
Organism
hsa  Homo sapiens (human)
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     63928 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST TerB EF-hand_9 DIMCO_N
Motif
Other DBs
NCBI-GeneID: 63928
NCBI-ProteinID: NP_071380
HGNC: 24927
Ensembl: ENSG00000166869
Vega: OTTHUMG00000131611
Pharos: O43745(Tbio)
UniProt: O43745
Structure
PDB: 

Jmol
Position
16p12.2
AA seq 196 aa AA seqDB search
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgcgcagctcccacgccgcggtcattcccgacggggacagtattcggcgagag
accggcttctcccaagccagcctgctccgcctgcaccaccggttccgggcactggacagg
aataagaagggctacctgagccgcatggatctccagcagataggggcgctcgccgtgaac
cccctgggagaccgaattatagaaagcttcttccccgatgggagccagcgagtggatttc
ccaggctttgtcagggtcttggctcattttcgccctgtagaagatgaggacacagaaacc
caagaccccaagaaacctgaacctctcaacagcagaaggaacaaacttcactatgcattt
cagctctatgacctggatcgcgatgggaagatctccaggcatgagatgctgcaggttctc
cgtctgatggttggggtacaggtgacagaagagcagctggagaacatcgctgaccgcacg
gtgcaggaggctgatgaagatggggatggggctgtgtccttcgtggagttcaccaagtcc
ttagagaagatggacgttgagcaaaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system