KEGG   Homo sapiens (human): 63928Help
Entry
63928             CDS       T01001                                 

Gene name
CHP2
Definition
calcineurin-like EF-hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
hsa  Homo sapiens (human)
Drug target
Tacrolimus: 
Pimecrolimus: 
Ciclosporin: 
Tacrolimus: 
Voclosporin: 
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     63928 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.2
AA seq 196 aa AA seqDB search
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgcgcagctcccacgccgcggtcattcccgacggggacagtattcggcgagag
accggcttctcccaagccagcctgctccgcctgcaccaccggttccgggcactggacagg
aataagaagggctacctgagccgcatggatctccagcagataggggcgctcgccgtgaac
cccctgggagaccgaattatagaaagcttcttccccgatgggagccagcgagtggatttc
ccaggctttgtcagggtcttggctcattttcgccctgtagaagatgaggacacagaaacc
caagaccccaagaaacctgaacctctcaacagcagaaggaacaaacttcactatgcattt
cagctctatgacctggatcgcgatgggaagatctccaggcatgagatgctgcaggttctc
cgtctgatggttggggtacaggtgacagaagagcagctggagaacatcgctgaccgcacg
gtgcaggaggctgatgaagatggggatggggctgtgtccttcgtggagttcaccaagtcc
ttagagaagatggacgttgagcaaaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system