KEGG   Homo sapiens (human): 63970Help
Entry
63970             CDS       T01001                                 

Gene name
TP53AIP1, P53AIP1
Definition
tumor protein p53 regulated apoptosis inducing protein 1
Orthology
K13773  
p53-regulated apoptosis-inducing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    63970 (TP53AIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
11q24
AA seq 120 aa AA seqDB search
MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHG
GCRGIEALSVSSGSWSSATVWILTGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgggatcttcctctgaggcgagcttcagatctgctcaagcttcctgcagtggggccagg
aggcagggcctgggcaggggagaccagaacctctcggtgatgcctccgaatggcagggct
cagacacacacacctggctgggtttcagatcccttagttttgggtgcccaagttcacgga
gggtgccggggaatagaagctctgtcagtctcgtctggatcttggtcctcagcaactgtc
tggatcctgacaggtctctccaggcctttccttcctggagccacagtgcttagagacagg
ccactggggtcagcatttgagctcagctatgatcagaaaaaagcaccgttgaggttgcag
tga

DBGET integrated database retrieval system