KEGG   Homo sapiens (human): 6400Help
Entry
6400              CDS       T01001                                 

Gene name
SEL1L, PRO1063, SEL1-LIKE, SEL1L1
Definition
sel-1 suppressor of lin-12-like (C. elegans)
Orthology
K14026  
SEL1 protein
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
HRD1/SEL1 ERAD complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6400 (SEL1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q31
AA seq 301 aa AA seqDB search
MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLPQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLVSR
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtccggatagggctgacgctgctgctgtgtgcggtgctgctgagcttggcctcg
gcgtcctcggatgaagaaggcagccaggatgaatccttagattccaagactactttgaca
tcagatgagtcagtaaaggaccatactactgcaggcagagtagttgctggtcaaatattt
cttgattcagaagaatctgaattagaatcctctattcaagaagaggaagacagcctcaag
agccaagagggggaaagtgtcacagaagatatcagctttctagagtctccaaatccagaa
aacaaggactatgaagagccaaagaaagtacggaaaccagctttgaccgccattgaaggc
acagcacatggggagccctgccacttcccttttcttttcctagataaggagtatgatgaa
tgtacatcagatgggagggaagatggcagactgtggtgtgctacaacctatgactacaaa
gcagatgaaaagtggggcttttgtgaaactgaagaagaggctgctaagagacggcagatg
caggaagcagaaatgatgtatcaaactggaatgaaaatccttaatggaagcaataagaaa
agccaaaaaagagaagcatatcggtatctccaaaaggcagcaagcatgaaccataccaaa
gccctggagagagtgtcatatgctcttttatttggtgattacttgccacagaatatccag
gcagcgagagagatgtttgagaagctgactgaggaaggctctcccaagggacagactgct
cttggctttctgtatgcctctggacttggtgttaattcaagtcaggcaaaggctcttgta
tattatacatttggagctcttgggggcaatctaatagcccacatggttttggtaagtaga
ctttag

DBGET integrated database retrieval system