KEGG   Homo sapiens (human): 6400Help
Entry
6400              CDS       T01001                                 

Gene name
SEL1L, PRO1063, SEL1-LIKE, SEL1L1
Definition
(RefSeq) SEL1L ERAD E3 ligase adaptor subunit
  KO
K14026  SEL1 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00403  HRD1/SEL1 ERAD complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6400 (SEL1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sel1 fn2
Motif
Other DBs
NCBI-GeneID: 6400
NCBI-ProteinID: NP_005056
OMIM: 602329
HGNC: 10717
Ensembl: ENSG00000071537
Vega: OTTHUMG00000171419
Pharos: Q9UBV2(Tbio)
UniProt: Q9UBV2 Q3ZCU6
Position
14q31.1
AA seq 794 aa AA seqDB search
MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLPQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EASIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQY
IRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPAPRPPGPRPA
PPQQEGPPEQQPPQ
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtccggatagggctgacgctgctgctgtgtgcggtgctgctgagcttggcctcg
gcgtcctcggatgaagaaggcagccaggatgaatccttagattccaagactactttgaca
tcagatgagtcagtaaaggaccatactactgcaggcagagtagttgctggtcaaatattt
cttgattcagaagaatctgaattagaatcctctattcaagaagaggaagacagcctcaag
agccaagagggggaaagtgtcacagaagatatcagctttctagagtctccaaatccagaa
aacaaggactatgaagagccaaagaaagtacggaaaccagctttgaccgccattgaaggc
acagcacatggggagccctgccacttcccttttcttttcctagataaggagtatgatgaa
tgtacatcagatgggagggaagatggcagactgtggtgtgctacaacctatgactacaaa
gcagatgaaaagtggggcttttgtgaaactgaagaagaggctgctaagagacggcagatg
caggaagcagaaatgatgtatcaaactggaatgaaaatccttaatggaagcaataagaaa
agccaaaaaagagaagcatatcggtatctccaaaaggcagcaagcatgaaccataccaaa
gccctggagagagtgtcatatgctcttttatttggtgattacttgccacagaatatccag
gcagcgagagagatgtttgagaagctgactgaggaaggctctcccaagggacagactgct
cttggctttctgtatgcctctggacttggtgttaattcaagtcaggcaaaggctcttgta
tattatacatttggagctcttgggggcaatctaatagcccacatggttttgggttacaga
tactgggctggcatcggcgtcctccagagttgtgaatctgccctgactcactatcgtctt
gttgccaatcatgttgctagtgatatctcgctaacaggaggctcagtagtacagagaata
cggctgcctgatgaagtggaaaatccaggaatgaacagtggaatgctagaagaagatttg
attcaatattaccagttcctagctgaaaaaggtgatgtacaagcacaggttggtcttgga
caactgcacctgcacggagggcgtggagtagaacagaatcatcagagagcatttgactac
ttcaatttagcagcaaatgctggcaattcacatgccatggcctttttgggaaagatgtat
tcggaaggaagtgacattgtacctcagagtaatgagacagctctccactactttaagaaa
gctgctgacatgggcaacccagttggacagagtgggcttggaatggcctacctctatggg
agaggagttcaagttaattatgatctagcccttaagtatttccagaaagctgctgaacaa
ggctgggtggatgggcagctacagcttggttccatgtactataatggcattggagtcaag
agagattataaacaggccttgaagtattttaatttagcttctcagggaggccatatcttg
gctttctataacctagctcagatgcatgccagtggcaccggcgtgatgcgatcatgtcac
actgcagtggagttgtttaagaatgtatgtgaacgaggccgttggtctgaaaggcttatg
actgcctataacagctataaagatggcgattacaatgctgcagtgatccagtacctcctc
ctggctgaacagggctatgaagtggcacaaagcaatgcagcctttattcttgatcagaga
gaagcaagcattgtaggtgagaatgaaacttatcccagagctttgctacattggaacagg
gccgcctctcaaggctatactgtggctagaattaagctcggagactaccatttctatggg
tttggcaccgatgtagattatgaaactgcatttattcattaccgtctggcttctgagcag
caacacagtgcacaagctatgtttaatctgggatatatgcatgagaaaggactgggcatt
aaacaggatattcaccttgcgaaacgtttttatgacatggcagctgaagccagcccagat
gcacaagttccagtcttcctagccctctgcaaattgggcgtcgtctatttcttgcagtac
atacgggaaacaaacattcgagatatgttcacccaacttgatatggaccagcttttggga
cctgagtgggacctttacctcatgaccatcattgcgctgctgttgggaacagtcatagct
tacaggcaaaggcagcaccaagacatgcctgcacccaggcctccagggccacggccagct
ccaccccagcaggaggggccaccagagcagcagccaccacagtaa

DBGET integrated database retrieval system