KEGG   Homo sapiens (human): 6404Help
Entry
6404              CDS       T01001                                 

Gene name
SELPLG, CD162, CLA, PSGL-1, PSGL1
Definition
(RefSeq) selectin P ligand
  KO
K06544  selectin P ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6404 (SELPLG)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    6404 (SELPLG)
Cell adhesion molecules and their ligands [BR:hsa04516]
 3. Selectin Family
  SELL; selectin, lymphocyte [KO:K06495]
   6404 (SELPLG)
  SELE; selectin, endothelial cell [KO:K06494]
   6404 (SELPLG)
  SELP; selectin, platelet [KO:K06496]
   6404 (SELPLG)
CD molecules [BR:hsa04090]
 Proteins
  6404 (SELPLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4689 Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 6404
NCBI-ProteinID: NP_002997
OMIM: 600738
HGNC: 10722
Ensembl: ENSG00000110876
Vega: OTTHUMG00000169411
Pharos: Q14242(Tbio)
UniProt: Q14242
Position
12q24.11
AA seq 412 aa AA seqDB search
MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPP
EMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAME
IQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATE
AQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATE
AQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAA
SNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPT
EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcaactcctcctgttgctgatcctactgggccctggcaacagcttgcagctg
tgggacacctgggcagatgaagccgagaaagccttgggtcccctgcttgcccgggaccgg
agacaggccaccgaatatgagtacctagattatgatttcctgccagaaacggagcctcca
gaaatgctgaggaacagcactgacaccactcctctgactgggcctggaacccctgagtct
accactgtggagcctgctgcaaggcgttctactggcctggatgcaggaggggcagtcaca
gagctgaccacggagctggccaacatggggaacctgtccacggattcagcagctatggag
atacagaccactcaaccagcagccacggaggcacagaccactcaaccagtgcccacggag
gcacagaccactccactggcagccacagaggcacagacaactcgactgacggccacggag
gcacagaccactccactggcagccacagaggcacagaccactccaccagcagccacggaa
gcacagaccactcaacccacaggcctggaggcacagaccactgcaccagcagccatggag
gcacagaccactgcaccagcagccatggaagcacagaccactccaccagcagccatggag
gcacagaccactcaaaccacagccatggaggcacagaccactgcaccagaagccacggag
gcacagaccactcaacccacagccacggaggcacagaccactccactggcagccatggag
gccctgtccacagaacccagtgccacagaggccctgtccatggaacctactaccaaaaga
ggtctgttcatacccttttctgtgtcctctgttactcacaagggcattcccatggcagcc
agcaatttgtccgtcaactacccagtgggggccccagaccacatctctgtgaagcagtgc
ctgctggccatcctaatcttggcgctggtggccactatcttcttcgtgtgcactgtggtg
ctggcggtccgcctctcccgcaagggccacatgtaccccgtgcgtaattactcccccacc
gagatggtctgcatctcatccctgttgcctgatgggggtgaggggccctctgccacagcc
aatgggggcctgtccaaggccaagagcccgggcctgacgccagagcccagggaggaccgt
gagggggatgacctcaccctgcacagcttcctcccttag

DBGET integrated database retrieval system