KEGG   Homo sapiens (human): 6404Help
Entry
6404              CDS       T01001                                 

Gene name
SELPLG, CD162, CLA, PSGL-1, PSGL1
Definition
selectin P ligand
Orthology
K06544  
selectin P ligand
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Staphylococcus aureus infection
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24
AA seq 428 aa AA seqDB search
MAVGASGLEGDKMAGAMPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQAT
EYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTT
ELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTT
PLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTT
QTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFI
PFSVSSVTHKGIPMAASNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVR
LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDD
LTLHSFLP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgggggccagtggtctagaaggagataagatggctggtgccatgcctctgcaa
ctcctcctgttgctgatcctactgggccctggcaacagcttgcagctgtgggacacctgg
gcagatgaagccgagaaagccttgggtcccctgcttgcccgggaccggagacaggccacc
gaatatgagtacctagattatgatttcctgccagaaacggagcctccagaaatgctgagg
aacagcactgacaccactcctctgactgggcctggaacccctgagtctaccactgtggag
cctgctgcaaggcgttctactggcctggatgcaggaggggcagtcacagagctgaccacg
gagctggccaacatggggaacctgtccacggattcagcagctatggagatacagaccact
caaccagcagccacggaggcacagaccactcaaccagtgcccacggaggcacagaccact
ccactggcagccacagaggcacagacaactcgactgacggccacggaggcacagaccact
ccactggcagccacagaggcacagaccactccaccagcagccacggaagcacagaccact
caacccacaggcctggaggcacagaccactgcaccagcagccatggaggcacagaccact
gcaccagcagccatggaagcacagaccactccaccagcagccatggaggcacagaccact
caaaccacagccatggaggcacagaccactgcaccagaagccacggaggcacagaccact
caacccacagccacggaggcacagaccactccactggcagccatggaggccctgtccaca
gaacccagtgccacagaggccctgtccatggaacctactaccaaaagaggtctgttcata
cccttttctgtgtcctctgttactcacaagggcattcccatggcagccagcaatttgtcc
gtcaactacccagtgggggccccagaccacatctctgtgaagcagtgcctgctggccatc
ctaatcttggcgctggtggccactatcttcttcgtgtgcactgtggtgctggcggtccgc
ctctcccgcaagggccacatgtaccccgtgcgtaattactcccccaccgagatggtctgc
atctcatccctgttgcctgatgggggtgaggggccctctgccacagccaatgggggcctg
tccaaggccaagagcccgggcctgacgccagagcccagggaggaccgtgagggggatgac
ctcaccctgcacagcttcctcccttag

DBGET integrated database retrieval system