KEGG   Homo sapiens (human): 6405Help
Entry
6405              CDS       T01001                                 

Gene name
SEMA3F, SEMA-IV, SEMA4, SEMAK
Definition
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F
Orthology
K06840  
semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    6405 (SEMA3F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 785 aa AA seqDB search
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTIAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQELEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
QGLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSMSAPPPPGA
GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRH
HPPDT
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcgccggtcttcttctctgggcttccctactgaccggggcctggccatccttc
cccacccaggaccacctcccggccacgccccgggtccggctctcattcaaagagctgaag
gccacaggcaccgcccacttcttcaacttcctgctcaacacaaccgactaccgaatcttg
ctcaaggacgaggaccacgaccgcatgtacgtgggcagcaaggactacgtgctgtccctg
gacctgcacgacatcaaccgcgagcccctcattatacactgggcagcctccccacagcgc
atcgaggaatgcgtgctctcaggcaaggatgtcaacggcgagtgtgggaacttcgtcagg
ctcatccagccctggaaccgaacacacctgtatgtgtgcgggacaggtgcctacaacccc
atgtgcacctatgtgaaccgcggacgccgcgcccaggccacaccatggacccagactcag
gcggtcagaggccgcggcagcagagccacggatggtgccctccgcccgatgcccacagcc
ccacgccaggattacatcttctacctggagcctgagcgactcgagtcagggaagggcaag
tgtccgtacgatcccaagctggacacagcatcggccctcatcaatgaggagctctatgct
ggtgtgtacatcgattttatgggcactgatgcagccatcttccgcacacttggaaagcag
acagccatgcgcacggatcagtacaactcccggtggctgaacgacccgtcgttcatccat
gctgagctcattcctgacagtgcggagcgcaatgatgataagctttacttcttcttccgt
gagcggtcggcagaggcgccgcagagccccgcggtgtacgcccgcatcgggcgcatttgc
ctgaacgatgacggtggtcactgttgcctggtcaacaagtggagcacattcctgaaggcg
cggctcgtctgctctgtcccgggcgaggatggcattgagactcactttgatgagctccag
gacgtgtttgtccagcagacccaggacgtgaggaaccctgtcatttacgctgtctttacc
tcctctggctccgtgttccgaggctctgccgtgtgtgtctactccatggctgatattcgc
atggtcttcaacgggccctttgcccacaaagaggggcccaactaccagtggatgcccttc
tcagggaagatgccctacccacggccgggcacgtgccctggtggaaccttcacgccatct
atgaagtccaccaaggattatcctgatgaggtgatcaacttcatgcgcagccacccactc
atgtaccaggccgtgtaccctctgcagcggcggcccctggtagtccgcacaggtgctccc
taccgccttaccactattgccgtggaccaggtggatgcagccgacgggcgctatgaggtg
cttttcctgggcacagaccgcgggacagtgcagaaggtcattgtgctgcccaaggatgac
caggagttggaggagctcatgctggaggaggtggaggtcttcaaggatccagcacccgtc
aagaccatgaccatctcttctaagaggcaacaactctacgtggcgtcagccgtgggtgtc
acacacctgagcctgcaccgctgccaggcgtatggggctgcctgtgctgactgctgcctt
gcccgggacccttactgtgcctgggatggccaggcctgctcccgctatacagcatcctcc
aagaggcggagccgccggcaggacgtccggcacggaaaccccatcaggcagtgccgtggg
ttcaactccaatgccaacaagaatgccgtggagtctgtgcagtatggcgtggccggcagc
gcagccttccttgagtgccagccccgctcgccccaagccactgttaagtggctgttccag
cgagatcctggtgaccggcgccgagagattcgtgcagaggaccgcttcctgcgcacagag
cagggcttgttgctccgtgcactgcagctcagcgatcgtggcctctactcctgcacagcc
actgagaacaactttaagcacgtcgtcacacgagtgcagctgcatgtactgggccgggac
gccgtccatgctgccctcttcccaccactgtccatgagcgccccgccacccccaggcgca
ggccccccaacgcctccttaccaggagttagcccagctgctggcccagccagaagtgggc
ctcatccaccagtactgccagggttactggcgccatgtgccccccagccccagggaggct
ccaggggcaccccggtctcctgagccccaggaccagaaaaagccccggaaccgccggcac
caccctccggacacatga

DBGET integrated database retrieval system