KEGG   Homo sapiens (human): 64061Help
Entry
64061             CDS       T01001                                 

Gene name
TSPYL2, CDA1, CINAP, CTCL, DENTT, HRIHFB2216, NP79, SE204, TSPX
Definition
(RefSeq) TSPY-like 2
  KO
K11285  
TSPY-like 2
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     64061 (TSPYL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.2
AA seq 693 aa AA seqDB search
MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLAD
MRGVGLGPALPPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPT
PEASGGSLEIDFQVVQSSSFGGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDER
ESMRSSRRRRRRRRRKQRKVKRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLRL
KRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLR
HISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDA
SHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCE
VVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSE
NPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYG
NNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDD
RDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSED
VWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcccagatgaggggcctccggccaagacccgccgcctgagcagctccgagtct
ccacagcgcgacccgcccccgccgccgccgccgccgccgctcctccgactgccgctgcct
ccaccccagcagcgcccgaggctccaggaggaaacggaggcggcacaggtgctggccgat
atgaggggggtgggactgggccccgcgctgcccccgccgcctccctatgtcattctcgag
gagggggggatccgcgcatacttcacgctcggtgctgagtgtcccggctgggattctacc
atcgagtcggggtatggggaggcgcccccgcccacggagagcctggaagcactccccact
cctgaggcctcgggggggagcctggaaatcgattttcaggttgtacagtcgagcagtttt
ggtggagagggggccctagaaacctgtagcgcagtggggtgggcgccccagaggttagtt
gacccgaagagcaaggaagaggcgatcatcatagtggaggatgaggatgaggatgagcgg
gagagtatgaggagcagcaggaggcggcggcggcggcggaggaggaagcagaggaaggtg
aagagggaaagcagagagagaaatgccgagaggatggagagcatcctgcaggcactggag
gatattcagctggatctggaggcagtgaacatcaaggcaggcaaagccttcctgcgtctc
aagcgcaagttcatccagatgcgaagacccttcctggagcgcagagacctcatcatccag
catatcccaggcttctgggtcaaagcattcctcaaccaccccagaatttcaattttgatc
aaccgacgtgatgaagacattttccgctacttgaccaatctgcaggtacaggatctcaga
catatctccatgggctacaaaatgaagctgtacttccagactaacccctacttcacaaac
atggtgattgtcaaggagttccagcgcaaccgctcaggccggctggtgtctcactcaacc
ccaatccgctggcaccggggccaggaaccccaggcccgtcgtcacgggaaccaggatgcg
agccacagctttttcagctggttctcaaaccatagcctcccagaggctgacaggattgct
gagattatcaagaatgatctgtgggttaaccctctacgctactacctgagagaaaggggc
tccaggataaagagaaagaagcaagaaatgaagaaacgtaaaaccaggggcagatgtgag
gtggtgatcatggaagacgcccctgactattatgcagtggaagacattttcagcgagatc
tcagacattgatgagacaattcatgacatcaagatctctgacttcatggagaccaccgac
tacttcgagaccactgacaatgagataactgacatcaatgagaacatctgcgacagcgag
aatcctgaccacaatgaggtccccaacaacgagaccactgataacaacgagagtgctgat
gaccacgaaaccactgacaacaatgagagtgcagatgacaacaacgagaatcctgaagac
aataacaagaacactgatgacaacgaagagaaccctaacaacaacgagaacacttacggc
aacaacttcttcaaaggtggcttctggggcagccatggcaacaaccaggacagcagcgac
agtgacaatgaagcagatgaggccagtgatgatgaagataatgatggcaacgaaggtgac
aatgagggcagtgatgatgatggcaatgaaggtgacaatgaaggcagcgatgatgacgac
agagacattgagtactatgagaaagttattgaagactttgacaaggatcaggctgactac
gaggacgtgatagagatcatctcagacgaatcagtggaagaagagggcattgaggaaggc
atccagcaagatgaggacatctatgaggaaggaaactatgaggaggaaggaagtgaagat
gtctgggaagaaggggaagattcggacgactctgacctagaggatgtgcttcaggtccca
aacggttgggccaatccggggaagagggggaaaaccggataa

DBGET integrated database retrieval system