KEGG   Homo sapiens (human): 64065Help
Entry
64065             CDS       T01001                                 

Gene name
PERP, KCP1, KRTCAP1, PIGPC1, THW, dJ496H19.1
Definition
PERP, TP53 apoptosis effector
Orthology
K10136  
TP53 apoptosis effector
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    64065 (PERP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q24
AA seq 193 aa AA seqDB search
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGS
YEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDL
LGNAKPRYFYTSA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctgcggcctggcctgcgagcgctgccgctggatcctgcccctgctcctactc
agcgccatcgccttcgacatcatcgcgctggccggccgcggctggttgcagtctagcgac
cacggccagacgtcctcgctgtggtggaaatgctcccaagagggcggcggcagcgggtcc
tacgaggagggctgtcagagcctcatggagtacgcgtggggtagagcagcggctgccatg
ctcttctgtggcttcatcatcctggtgatctgtttcatcctctccttcttcgccctctgt
ggaccccagatgcttgtcttcctgagagtgattggaggtctccttgccttggctgctgtg
ttccagatcatctccctggtaatttaccccgtgaagtacacccagaccttcacccttcat
gccaaccctgctgtcacttacatctataactgggcctacggctttgggtgggcagccacg
attatcctgattggctgtgccttcttcttctgctgcctccccaactacgaagatgacctt
ctgggcaatgccaagcccaggtacttctacacatctgcctaa

DBGET integrated database retrieval system