KEGG   Homo sapiens (human): 64065Help
Entry
64065             CDS       T01001                                 

Gene name
PERP, KCP1, KRTCAP1, PIGPC1, RP3-496H19.1, THW, dJ496H19.1
Definition
PERP, TP53 apoptosis effector
Orthology
K10136  
TP53 apoptosis effector
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Class
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q24
AA seq 193 aa AA seqDB search
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGS
YEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDL
LGNAKPRYFYTSA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctgcggcctggcctgcgagcgctgccgctggatcctgcccctgctcctactc
agcgccatcgccttcgacatcatcgcgctggccggccgcggctggttgcagtctagcgac
cacggccagacgtcctcgctgtggtggaaatgctcccaagagggcggcggcagcgggtcc
tacgaggagggctgtcagagcctcatggagtacgcgtggggtagagcagcggctgccatg
ctcttctgtggcttcatcatcctggtgatctgtttcatcctctccttcttcgccctctgt
ggaccccagatgcttgtcttcctgagagtgattggaggtctccttgccttggctgctgtg
ttccagatcatctccctggtaatttaccccgtgaagtacacccagaccttcacccttcat
gccaaccctgctgtcacttacatctataactgggcctacggctttgggtgggcagccacg
attatcctgattggctgtgccttcttcttctgctgcctccccaactacgaagatgacctt
ctgggcaatgccaagcccaggtacttctacacatctgcctaa

DBGET integrated database retrieval system