KEGG   Homo sapiens (human): 64080Help
Entry
64080             CDS       T01001                                 

Gene name
RBKS, RBSK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hsa00030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p23.3
AA seq 255 aa AA seqDB search
MTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGA
NLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDP
QFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQT
EPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIAAVSVQAAGT
QSSYPYKKDLPLTLF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccatggtgtgtaaggttggcaaagattcttttggcaatgattatatagaaaac
ttaaaacagaatgatatttctacagaatttacatatcagactaaagatgctgctacagga
actgcttctataattgtcaataatgaaggccagaatatcattgtcatagtggctggagca
aatttacttttgaatacggaggatctgagggcagcagccaatgtcattagcagagccaaa
gtcatggtctgccagctcgaaataactccagcaacttctttggaagccctaacaatggcc
cgcaggagtggagtgaaaaccttgttcaatccagcccctgccattgctgacctggatccc
cagttctacaccctctcagatgtgttctgctgcaatgaaagtgaggctgagattttaact
ggcctcacggtgggcagcgctgcagatgctggggaggctgcattagtgctcttgaaaagg
ggctgccaggtggtaatcattaccttaggggctgaaggatgtgtggtgctgtcacagaca
gaacctgagccaaagcacattcccacagagaaagtcaaggctgtggataccacgggtgct
ggtgacagctttgtgggagctctggccttctacctggcttactatccaaatctgtccttg
gaagacatgctcaacagatccaatttcattgcagcagtcagtgtccaggctgcaggaaca
cagtcatcttacccttacaaaaaagaccttccgcttactctgttttga

DBGET integrated database retrieval system