KEGG   Homo sapiens (human): 64087Help
Entry
64087             CDS       T01001                                 

Gene name
MCCC2, MCCB
Definition
(RefSeq) methylcrotonoyl-CoA carboxylase 2 (EC:6.4.1.4)
  KO
K01969  
3-methylcrotonyl-CoA carboxylase beta subunit [EC:6.4.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Disease
H00181  
3-Methylcrotonylglycinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    64087 (MCCC2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     64087 (MCCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q12-q13
AA seq 563 aa AA seqDB search
MWAVLRLALRPCARASPAGPRAYHGDSVASLGTQPDLGSALYQENYKQMKALVNQLHERV
EHIKLGGGEKARALHISRGKLLPRERIDNLIDPGSPFLELSQFAGYQLYDNEEVPGGGII
TGIGRVSGVECMIIANDATVKGGAYYPVTVKKQLRAQEIAMQNRLPCIYLVDSGGAYLPR
QADVFPDRDHFGRTFYNQAIMSSKNIAQIAVVMGSCTAGGAYVPAMADENIIVRKQGTIF
LAGPPLVKAATGEEVSAEDLGGADLHCRKSGVSDHWALDDHHALHLTRKVVRNLNYQKKL
DVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIARIVDGSRFTEFKAFYGDTLVTGFA
RIFGYPVGIVGNNGVLFSESAKKGTHFVQLCCQRNIPLLFLQNITGFMVGREYEAEGIAK
DGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAAN
VLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLV
LGLSFSAALNAPIEKTDFGIFRM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccgtcctgaggttagccctgcggccgtgtgcccgcgcctctcccgccgggccg
cgcgcctatcacggggactcggtggcctcgctgggcacccagccggacttgggctctgcc
ctctaccaggagaactacaagcagatgaaagcactagtaaatcagctccatgaacgagtg
gagcatataaaactaggaggtggtgagaaagcccgagcacttcacatatcaagaggaaaa
ctattgcccagagaaagaattgacaatctcatagacccagggtctccatttctggaatta
tcccagtttgcaggttaccagttatatgacaatgaggaggtgccaggaggtggcattatt
acaggcattggaagagtatcaggagtagaatgcatgattattgccaatgatgccaccgtc
aaaggaggtgcctactacccagtgactgtgaaaaaacaattacgggcccaagaaattgcc
atgcaaaacaggctcccctgcatctacttagttgattcgggaggagcatacttacctcga
caagcagatgtgtttccagatcgagaccactttggccgtacattctataatcaggcaatt
atgtcttctaaaaatattgcacagatcgcagtggtcatgggctcctgcaccgcaggagga
gcctatgtgcctgccatggctgatgaaaacatcattgtacgcaagcagggtaccattttc
ttggcaggaccccccttggttaaagcggcaactggggaagaagtatctgctgaggatctt
ggaggtgctgatcttcattgcagaaagtctggagtaagtgaccactgggctttggatgat
catcatgcccttcacttaactaggaaggttgtgaggaatctaaattatcagaagaaattg
gatgtcaccattgaaccttctgaagagcctttatttcctgctgatgaattgtatggaata
gttggtgctaaccttaagaggagctttgatgtccgagaggtcattgctagaatcgtggat
ggaagcagattcactgagttcaaagccttttatggagacacattagttacaggatttgct
cgaatatttgggtacccagtaggtatcgttggaaacaacggagttctcttttctgaatct
gcaaaaaagggtactcactttgtccagttatgctgccaaagaaatattcctctgctgttc
cttcaaaacattactggatttatggttggtagagagtatgaagctgaaggaattgccaag
gatggtgccaagatggtggccgctgtggcctgtgcccaagtgcctaagataaccctcatc
attgggggctcctatggagccggaaactatgggatgtgtggcagagcatatagcccaaga
tttctctacatttggccaaatgctcgtatctcagtgatgggaggagagcaggcagccaat
gtgttggccacgataacaaaggaccaaagagcccgggaaggaaagcagttctccagtgct
gatgaagcggctttaaaagagcccatcattaagaagtttgaagaggaaggaaacccttac
tattccagcgcaagggtatgggatgatgggatcattgatccagcagacaccagactggtc
ttgggtctcagttttagtgcagccctcaacgcaccaatagagaagactgacttcggtatc
ttcaggatgtaa

DBGET integrated database retrieval system