KEGG   Homo sapiens (human): 64098Help
Entry
64098             CDS       T01001                                 

Gene name
PARVG
Definition
parvin, gamma
Orthology
K06275  
parvin
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    64098 (PARVG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64098 (PARVG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.31
AA seq 331 aa AA seqDB search
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagccggagttcttgtacgacctgctgcagctccccaagggggtggagcccccagcg
gaggaggagctctcaaaaggaggaaagaagaaatacctgccacccacttcccggaaggac
cccaaatttgaagaactgcagaaggtgttgatggagtggatcaatgccactcttctcccc
gagcacattgtggtccgcagcctggaggaggacatgttcgacgggctcatcctacaccac
ctattccagaggctggcggcgctcaagctggaagcagaggacatcgccctgacagccaca
agccagaagcacaagctcacagtggtgctggaggccgtgaaccggagtctgcagctggag
gagtggcaggccaagtggagcgtggagagcatcttcaacaaggacctgttgtctaccctg
cacctccttgtggccctggccaagcgcttccagcccgacctctccctcccaaccaacgtc
caggtggaggtcatcactatcgagagcaccaaaagtggtctgaagtcagagaagttggtg
gaacagctcactgaatacagcacagacaaggacgagcctccaaaggacgtctttgatgaa
ttatttaagctggctccggagaaagtgaacgcagtgaaagaggccatcgtgaactttgtc
aaccagaagctggaccgcctgggcctgtctgtgcagaatctggacacccagtttgcagat
ggggtcatcttactcttgctgattggacaacttgaaggcttcttcctgcacttaaaggaa
ttctacctcactcccaactctcctgcagaaatgctgcacaacgtcaccctggcgctggag
ctgctgaaggacgagggcctgctcagctgccctgtcagccctgaagatatcgtgaacaag
gatgccaagagcacactgagggtgctctatggtctgttctgcaagcacacgcagaaggca
cacagggacaggacgccccatggagccccgaattga

DBGET integrated database retrieval system