KEGG   Homo sapiens (human): 64108Help
Entry
64108             CDS       T01001                                 

Gene name
RTP4, IFRG28, Z3CXXC4
Definition
(RefSeq) receptor (chemosensory) transporter protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3q27.3
AA seq 246 aa AA seqDB search
MVVDFWTWEQTFQELIQEAKPRATWTLKLDGNLQLDCLAQGWKQYQQRAFGWFRCSSCQR
SWASAQVQILCHTYWEHWTSQGQVRMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQ
HILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICGQGLKSCMTKPSKSLLPH
LKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDPLNICVFILLLVFIVV
KCFTSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagatttctggacttgggagcagacatttcaagaactaatccaagaggcaaaa
ccccgggccacatggacgctgaagttggatggcaaccttcagctagactgcctggctcaa
gggtggaagcaataccaacagagagcatttggctggttccggtgttcctcctgccagcga
agttgggcttccgcccaagtgcagattctgtgccacacgtactgggagcactggacatcc
cagggtcaggtgcgtatgaggctctttggccaaaggtgccagaagtgctcctggtcccaa
tatgagatgcctgagttctcctcggatagcaccatgaggattctgagcaacctggtgcag
catatactgaagaaatactatggaaatggcacgaggaagtctccagaaatgccagtaatc
ctggaagtgtccctggaaggatcccatgacacagccaattgtgaggcatgcactttgggc
atctgtggacagggcttaaaaagctgcatgacaaagccgtccaaatccctactcccccac
ctaaagactgggaattcctcacctggaattggtgctgtgtacctcgcaaaccaagccaag
aaccagtcagctgaggcaaaagaggctaaggggagtgggtatgagaaattagggcccagt
cgagacccagatccactgaacatctgtgtctttattttgctgcttgtatttattgtagtc
aaatgctttacatcagaatga

DBGET integrated database retrieval system