KEGG   Homo sapiens (human): 64109Help
Entry
64109             CDS       T01001                                 

Gene name
CRLF2, CRL2, CRLF2Y, TSLPR
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  
thymic stromal-derived lymphopoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    64109 (CRLF2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64109 (CRLF2)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  64109 (CRLF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.3; Yp11.3
AA seq 371 aa AA seqDB search
MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHY
RFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPS
SPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKC
YSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKFILISSLAI
LLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHLHKMA
GAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGGDVVTIGGFT
FVMNDRSYVAL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctggttctgctgtggggagctgccgtctttctgctgggaggctggatggct
ttggggcaaggaggagcagcagaaggagtacagattcagatcatctacttcaatttagaa
accgtgcaggtgacatggaatgccagcaaatactccaggaccaacctgactttccactac
agattcaacggtgatgaggcctatgaccagtgcaccaactaccttctccaggaaggtcac
acttcggggtgcctcctagacgcagagcagcgagacgacattctctatttctccatcagg
aatgggacgcaccccgttttcaccgcaagtcgctggatggtttattacctgaaacccagt
tccccgaagcacgtgagattttcgtggcatcaggatgcagtgacggtgacgtgttctgac
ctgtcctacggggatctcctctatgaggttcagtaccggagccccttcgacaccgagtgg
cagtccaaacaggaaaatacctgcaacgtcaccatagaaggcttggatgccgagaagtgt
tactctttctgggtcagggtgaaggctatggaggatgtatatgggccagacacataccca
agcgactggtcagaggtgacatgctggcagagaggcgagattcgggatgcctgtgcagag
acaccaacgcctcccaaaccaaagctgtccaaatttattttaatttccagcctggccatc
cttctgatggtgtctctcctccttctgtctttatggaaattatggagagtgaagaagttt
ctcattcccagcgtgccagacccgaaatccatcttccccgggctctttgagatacaccaa
gggaacttccaggagtggatcacagacacccagaacgtggcccacctccacaagatggca
ggtgcagagcaagaaagtggccccgaggagcccctggtagtccagttggccaagactgaa
gccgagtctcccaggatgctggacccacagaccgaggagaaagaggcctctgggggatcc
ctccagcttccccaccagcccctccaaggcggtgatgtggtcacaatcgggggcttcacc
tttgtgatgaatgaccgctcctacgtggcgttgtga

DBGET integrated database retrieval system