KEGG   Homo sapiens (human): 64123Help
Entry
64123             CDS       T01001                                 

Gene name
ADGRL4, ELTD1, ETL, KPG_003
Definition
(RefSeq) adhesion G protein-coupled receptor L4
  KO
K04595  
latrophilin and seven transmembrane domain containing 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Latrophilin
    64123 (ADGRL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33-p32
AA seq 690 aa AA seqDB search
MKRLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN
ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNV
CIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTI
SAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSF
QKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFV
YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITFTLSHR
KVTDRYRSLCAFWNYSPDTMNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIG
IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG
INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLS
PAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI
FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcctcccgctcctagtggttttttccactttgttgaattgttcctatactcaa
aattgcaccaagacaccttgtctcccaaatgcaaaatgtgaaatacgcaatggaattgaa
gcctgctattgcaacatgggattttcaggaaatggtgtcacaatttgtgaagatgataat
gaatgtggaaatttaactcagtcctgtggcgaaaatgctaattgcactaacacagaagga
agttattattgtatgtgtgtacctggcttcagatccagcagtaaccaagacaggtttatc
actaatgatggaaccgtctgtatagaaaatgtgaatgcaaactgccatttagataatgtc
tgtatagctgcaaatattaataaaactttaacaaaaatcagatccataaaagaacctgtg
gctttgctacaagaagtctatagaaattctgtgacagatctttcaccaacagatataatt
acatatatagaaatattagctgaatcatcttcattactaggttacaagaacaacactatc
tcagccaaggacaccctttctaactcaactcttactgaatttgtaaaaaccgtgaataat
tttgttcaaagggatacatttgtagtttgggacaagttatctgtgaatcataggagaaca
catcttacaaaactcatgcacactgttgaacaagctactttaaggatatcccagagcttc
caaaagaccacagagtttgatacaaattcaacggatatagctctcaaagttttctttttt
gattcatataacatgaaacatattcatcctcatatgaatatggatggagactacataaat
atatttccaaagagaaaagctgcatatgattcaaatggcaatgttgcagttgcatttgta
tattataagagtattggtcctttgctttcatcatctgacaacttcttattgaaacctcaa
aattatgataattctgaagaggaggaaagagtcatatcttcagtaatttcagtctcaatg
agctcaaacccacccacattatatgaacttgaaaaaataacatttacattaagtcatcga
aaggtcacagataggtataggagtctatgtgcattttggaattactcacctgataccatg
aatggcagctggtcttcagagggctgtgagctgacatactcaaatgagacccacacctca
tgccgctgtaatcacctgacacattttgcaattttgatgtcctctggtccttccattggt
attaaagattataatattcttacaaggatcactcaactaggaataattatttcactgatt
tgtcttgccatatgcatttttaccttctggttcttcagtgaaattcaaagcaccaggaca
acaattcacaaaaatctttgctgtagcctatttcttgctgaacttgtttttcttgttggg
atcaatacaaatactaataagctcttctgttcaatcattgccggactgctacactacttc
tttttagctgcttttgcatggatgtgcattgaaggcatacatctctatctcattgttgtg
ggtgtcatctacaacaagggatttttgcacaagaatttttatatctttggctatctaagc
ccagccgtggtagttggattttcggcagcactaggatacagatattatggcacaaccaaa
gtatgttggcttagcaccgaaaacaactttatttggagttttataggaccagcatgccta
atcattcttgttaatctcttggcttttggagtcatcatatacaaagtttttcgtcacact
gcagggttgaaaccagaagttagttgctttgagaacataaggtcttgtgcaagaggagcc
ctcgctcttctgttccttctcggcaccacctggatctttggggttctccatgttgtgcac
gcatcagtggttacagcttacctcttcacagtcagcaatgctttccaggggatgttcatt
tttttattcctgtgtgttttatctagaaagattcaagaagaatattacagattgttcaaa
aatgtcccctgttgttttggatgtttaaggtaa

DBGET integrated database retrieval system