KEGG   Homo sapiens (human): 64131Help
Entry
64131             CDS       T01001                                 

Gene name
XYLT1, DBQD2, PXYLT1, XT-I, XT1, XTI, XYLTI
Definition
xylosyltransferase I (EC:2.4.2.26)
Orthology
K00771  
protein xylosyltransferase [EC:2.4.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    64131 (XYLT1)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    64131 (XYLT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.26  protein xylosyltransferase
     64131 (XYLT1)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Glycosaminoglycan (Xyl b1- Ser/Thr)
   64131 (XYLT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.3
AA seq 959 aa AA seqDB search
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPA
PAPRRERRDLPAEPAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARA
LDPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPE
LAKKPPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHAR
KTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRF
CPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHV
DKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFI
NLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGD
RRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSP
HCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF
EAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGL
RRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVM
PKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTV
TVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVA
PLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGT
ALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcgccgtgcgcccggaggctggcccggcgctcgcactcggcgctgctcgcg
gcgctcacggtgctgctgctgcagacgctggtcgtgtggaatttcagcagcctcgactcc
ggggccggggagcgccgcgggggcgcagcggtcggcggcggggagcagccgcccccggcc
ccggccccgcgccgggagcgccgggacctgcccgccgagccggctgcagcccgaggagga
ggaggaggcggcggcggaggaggaggaggacgggggccccaggcgcgggcgcggggaggc
ggccccggagaaccgcggggacagcagccggccagccggggggcactgcccgcccgggct
ctggatccacacccaagtccgctcatcaccctggagactcaggatggctacttttctcat
cggccgaaagagaaagtgcgaacagacagcaacaacgagaactctgtccccaaagacttt
gagaatgtcgacaacagcaacttcgcacccaggactcaaaagcagaagcaccagcctgag
ttggcgaagaagccaccgagtagacagaaggagcttttgaaaaggaagctggaacagcag
gagaaaggaaaaggacatacattccctgggaaaggccccggtgaggtgctgcctcccggg
gacagagccgcagccaacagcagccacgggaaggatgtgtccagaccgcctcatgccagg
aaaactgggggcagctcccccgagaccaagtatgaccagccccctaagtgtgacatctca
ggcaaggaggccatctctgccctgtcccgtgctaagtccaagcactgccgccaggagatt
ggggagacttactgccgccacaagttagggctgctgatgcctgagaaggtgactcggttc
tgccccctcgagggtaaagccaacaagaacgtgcagtgggacgaggactccgtggagtac
atgccagccaacccggtcagaatcgcctttgtcctggtggtccacggccgtgcctctcgg
cagttgcagcgcatgttcaaggccatctaccacaaagaccacttctactacatccacgtg
gacaagcgctctaattacctgcatcggcaagtgctccaggtctccaggcagtacagcaat
gtccgcgtcaccccctggagaatggccaccatctggggaggagccagcctcctgtccacc
tacctgcagagcatgcgggacctcctggagatgaccgactggccctgggacttcttcatc
aacctgagtgcggccgactaccccatcaggacaaatgaccagttggtggcgtttctctcc
cgataccgagatatgaatttcttgaagtcacacggccgggacaatgcaaggttcattcgg
aagcagggcctggatcggctcttcctggagtgcgacgctcacatgtggcgcctgggagat
cggcggatcccagagggcattgccgtggatggcggttcggactggttcctgctgaaccgg
aggtttgtagaatatgtgaccttctccacagacgatctggtgaccaagatgaaacagttc
tactcctacaccctgcttcctgctgagtccttcttccatacggtcctggagaacagcccc
cactgcgacaccatggtggacaacaacctgcgcatcaccaactggaatcgcaagctgggc
tgcaagtgccagtacaagcacatcgtggactggtgcggctgctcccccaatgacttcaag
ccgcaggacttccaccgcttccagcagacagcccggcctaccttctttgcccgcaagttt
gaagccgtggtgaatcaggaaatcattgggcagctggactattacctgtacgggaactac
cctgcaggtaccccgggcctgcgctcctactgggagaatgtctacgatgagcctgacggc
atccacagcctgagcgacgtgacactcaccttgtaccactcctttgcccgcctgggtctt
cgacgggccgagacgtccctgcacacggatggggagaacagctgccgatactacccaatg
ggccacccagcatctgtgcacctctacttccttgctgaccgcttccagggctttctgatc
aagcatcatgctaccaatctggctgtgagcaaactagagactctggagacctgggtgatg
ccgaaaaaagtcttcaagatcgcaagcccacccagtgactttgggaggcttcagttttcc
gaggtcggcactgactgggatgccaaggagaggctattccgcaactttgggggtcttctg
gggcccatggatgagccggtgggtatgcagaagtgggggaagggacctaatgtgaccgtg
accgtcatttgggtggatcccgtcaatgtcatcgcagccacctacgacatcctcattgag
tccactgccgaattcacacactacaagccccctttgaacttgcccctgaggcctggggtc
tggacagtgaaaattctccaccactgggtgccagttgcagagaccaaattcctcgttgcg
cctctgaccttctcgaacaggcagcccatcaaacctgaggaggcactgaagctgcacaat
gggcccctccgcaatgcctacatggagcagagcttccagagcctaaaccccgtcctcagc
ctgcccatcaaccccgcccaggtggaacaggcacggaggaacgcagcctccacgggcaca
gcgctggagggatggctggactcgttggtgggcgggatgtggactgccatggacatctgt
gccacgggccccacagcctgcccggtcatgcagacctgcagccagacggcctggagctcc
ttcagccctgaccccaagtcggagctgggggcagtcaaacctgatggccggctcaggtag

DBGET integrated database retrieval system