KEGG   Homo sapiens (human): 64131Help
Entry
64131             CDS       T01001                                 

Gene name
XYLT1, DBQD2, PXYLT1, XT-I, XT1, XTI, XYLTI, xylT-I
Definition
(RefSeq) xylosyltransferase 1
  KO
K00771  protein xylosyltransferase [EC:2.4.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
hsa01100  Metabolic pathways
Module
hsa_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Disease
H00494  Desbuquois syndrome
H00560  Pseudoxanthoma elasticum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    64131 (XYLT1)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    64131 (XYLT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.26  protein xylosyltransferase
     64131 (XYLT1)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Glycosaminoglycan
   64131 (XYLT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xylo_C Branch
Motif
Other DBs
NCBI-GeneID: 64131
NCBI-ProteinID: NP_071449
OMIM: 608124
HGNC: 15516
Ensembl: ENSG00000103489
Vega: OTTHUMG00000129975
Pharos: Q86Y38(Tbio)
UniProt: Q86Y38
Structure
PDB: 

Jmol
Position
16p12.3
AA seq 959 aa AA seqDB search
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPA
PAPRRERRDLPAEPAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARA
LDPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPE
LAKKPPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHAR
KTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRF
CPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHV
DKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFI
NLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGD
RRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSP
HCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF
EAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGL
RRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVM
PKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTV
TVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVA
PLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGT
ALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcgccgtgcgcccggaggctggcccggcgctcgcactcggcgctgctcgcg
gcgctcacggtgctgctgctgcagacgctggtcgtgtggaatttcagcagcctcgactcc
ggggccggggagcgccgcgggggcgcagcggtcggcggcggggagcagccgcccccggcc
ccggccccgcgccgggagcgccgggacctgcccgccgagccggctgcagcccgaggagga
ggaggaggcggcggcggaggaggaggaggacgggggccccaggcgcgggcgcggggaggc
ggccccggagaaccgcggggacagcagccggccagccggggggcactgcccgcccgggct
ctggatccacacccaagtccgctcatcaccctggagactcaggatggctacttttctcat
cggccgaaagagaaagtgcgaacagacagcaacaacgagaactctgtccccaaagacttt
gagaatgtcgacaacagcaacttcgcacccaggactcaaaagcagaagcaccagcctgag
ttggcgaagaagccaccgagtagacagaaggagcttttgaaaaggaagctggaacagcag
gagaaaggaaaaggacatacattccctgggaaaggccccggtgaggtgctgcctcccggg
gacagagccgcagccaacagcagccacgggaaggatgtgtccagaccgcctcatgccagg
aaaactgggggcagctcccccgagaccaagtatgaccagccccctaagtgtgacatctca
ggcaaggaggccatctctgccctgtcccgtgctaagtccaagcactgccgccaggagatt
ggggagacttactgccgccacaagttagggctgctgatgcctgagaaggtgactcggttc
tgccccctcgagggtaaagccaacaagaacgtgcagtgggacgaggactccgtggagtac
atgccagccaacccggtcagaatcgcctttgtcctggtggtccacggccgtgcctctcgg
cagttgcagcgcatgttcaaggccatctaccacaaagaccacttctactacatccacgtg
gacaagcgctctaattacctgcatcggcaagtgctccaggtctccaggcagtacagcaat
gtccgcgtcaccccctggagaatggccaccatctggggaggagccagcctcctgtccacc
tacctgcagagcatgcgggacctcctggagatgaccgactggccctgggacttcttcatc
aacctgagtgcggccgactaccccatcaggacaaatgaccagttggtggcgtttctctcc
cgataccgagatatgaatttcttgaagtcacacggccgggacaatgcaaggttcattcgg
aagcagggcctggatcggctcttcctggagtgcgacgctcacatgtggcgcctgggagat
cggcggatcccagagggcattgccgtggatggcggttcggactggttcctgctgaaccgg
aggtttgtagaatatgtgaccttctccacagacgatctggtgaccaagatgaaacagttc
tactcctacaccctgcttcctgctgagtccttcttccatacggtcctggagaacagcccc
cactgcgacaccatggtggacaacaacctgcgcatcaccaactggaatcgcaagctgggc
tgcaagtgccagtacaagcacatcgtggactggtgcggctgctcccccaatgacttcaag
ccgcaggacttccaccgcttccagcagacagcccggcctaccttctttgcccgcaagttt
gaagccgtggtgaatcaggaaatcattgggcagctggactattacctgtacgggaactac
cctgcaggtaccccgggcctgcgctcctactgggagaatgtctacgatgagcctgacggc
atccacagcctgagcgacgtgacactcaccttgtaccactcctttgcccgcctgggtctt
cgacgggccgagacgtccctgcacacggatggggagaacagctgccgatactacccaatg
ggccacccagcatctgtgcacctctacttccttgctgaccgcttccagggctttctgatc
aagcatcatgctaccaatctggctgtgagcaaactagagactctggagacctgggtgatg
ccgaaaaaagtcttcaagatcgcaagcccacccagtgactttgggaggcttcagttttcc
gaggtcggcactgactgggatgccaaggagaggctattccgcaactttgggggtcttctg
gggcccatggatgagccggtgggtatgcagaagtgggggaagggacctaatgtgaccgtg
accgtcatttgggtggatcccgtcaatgtcatcgcagccacctacgacatcctcattgag
tccactgccgaattcacacactacaagccccctttgaacttgcccctgaggcctggggtc
tggacagtgaaaattctccaccactgggtgccagttgcagagaccaaattcctcgttgcg
cctctgaccttctcgaacaggcagcccatcaaacctgaggaggcactgaagctgcacaat
gggcccctccgcaatgcctacatggagcagagcttccagagcctaaaccccgtcctcagc
ctgcccatcaaccccgcccaggtggaacaggcacggaggaacgcagcctccacgggcaca
gcgctggagggatggctggactcgttggtgggcgggatgtggactgccatggacatctgt
gccacgggccccacagcctgcccggtcatgcagacctgcagccagacggcctggagctcc
ttcagccctgaccccaagtcggagctgggggcagtcaaacctgatggccggctcaggtag

DBGET integrated database retrieval system