KEGG   Homo sapiens (human): 64135Help
Entry
64135             CDS       T01001                                 

Gene name
IFIH1, Hlcd, IDDM19, MDA-5, MDA5, RLR-2
Definition
interferon induced with helicase C domain 1 (EC:3.6.4.13)
Orthology
K12647  
interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Disease
H00408  
Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    64135 (IFIH1)
 Human Diseases
  Infectious diseases
   05162 Measles
    64135 (IFIH1)
   05164 Influenza A
    64135 (IFIH1)
   05161 Hepatitis B
    64135 (IFIH1)
   05168 Herpes simplex infection
    64135 (IFIH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     64135 (IFIH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q24
AA seq 1025 aa AA seqDB search
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVE
LLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNL
LQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSA
FLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGM
ENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARA
SPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVI
VLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIP
LPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFA
IADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVC
AEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDE
DDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESAR
GIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRT
GKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV
IEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNP
SLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEI
ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCL
FSDED
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgggtattccacagacgagaatttccgctatctcatctcgtgcttcagggcc
agggtgaaaatgtacatccaggtggagcctgtgctggactacctgacctttctgcctgca
gaggtgaaggagcagattcagaggacagtcgccacctccgggaacatgcaggcagttgaa
ctgctgctgagcaccttggagaagggagtctggcaccttggttggactcgggaattcgtg
gaggccctccggagaaccggcagccctctggccgcccgctacatgaaccctgagctcacg
gacttgccctctccatcgtttgagaacgctcatgatgaatatctccaactgctgaacctc
cttcagcccactctggtggacaagcttctagttagagacgtcttggataagtgcatggag
gaggaactgttgacaattgaagacagaaaccggattgctgctgcagaaaacaatggaaat
gaatcaggtgtaagagagctactaaaaaggattgtgcagaaagaaaactggttctctgca
tttctgaatgttcttcgtcaaacaggaaacaatgaacttgtccaagagttaacaggctct
gattgctcagaaagcaatgcagagattgagaatttatcacaagttgatggtcctcaagtg
gaagagcaacttctttcaaccacagttcagccaaatctggagaaggaggtctggggcatg
gagaataactcatcagaatcatcttttgcagattcttctgtagtttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggcagtgattcaggcaccatgggaagtgattcagatgaagagaatgtggcagcaagagca
tccccggagccagaactccagctcaggccttaccaaatggaagttgcccagccagccttg
gaagggaagaatatcatcatctgcctccctacagggagtggaaaaaccagagtggctgtt
tacattgccaaggatcacttagacaagaagaaaaaagcatctgagcctggaaaagttata
gttcttgtcaataaggtactgctagttgaacagctcttccgcaaggagttccaaccattt
ttgaagaaatggtatcgtgttattggattaagtggtgatacccaactgaaaatatcattt
ccagaagttgtcaagtcctgtgatattattatcagtacagctcaaatccttgaaaactcc
ctcttaaacttggaaaatggagaagatgctggtgttcaattgtcagacttttccctcatt
atcattgatgaatgtcatcacaccaacaaagaagcagtgtataataacatcatgaggcat
tatttgatgcagaagttgaaaaacaatagactcaagaaagaaaacaaaccagtgattccc
cttcctcagatactgggactaacagcttcacctggtgttggaggggccacgaagcaagcc
aaagctgaagaacacattttaaaactatgtgccaatcttgatgcatttactattaaaact
gttaaagaaaaccttgatcaactgaaaaaccaaatacaggagccatgcaagaagtttgcc
attgcagatgcaaccagagaagatccatttaaagagaaacttctagaaataatgacaagg
attcaaacttattgtcaaatgagtccaatgtcagattttggaactcaaccctatgaacaa
tgggccattcaaatggaaaaaaaagctgcaaaagaaggaaatcgcaaagaacgtgtttgt
gcagaacatttgaggaagtacaatgaggccctacaaattaatgacacaattcgaatgata
gatgcgtatactcatcttgaaactttctataatgaagagaaagataagaagtttgcagtc
atagaagatgatagtgatgagggtggtgatgatgagtattgtgatggtgatgaagatgag
gatgatttaaagaaacctttgaaactggatgaaacagatagatttctcatgactttattt
tttgaaaacaataaaatgttgaaaaggctggctgaaaacccagaatatgaaaatgaaaag
ctgaccaaattaagaaataccataatggagcaatatactaggactgaggaatcagcacga
ggaataatctttacaaaaacacgacagagtgcatatgcgctttcccagtggattactgaa
aatgaaaaatttgctgaagtaggagtcaaagcccaccatctgattggagctggacacagc
agtgagttcaaacccatgacacagaatgaacaaaaagaagtcattagtaaatttcgcact
ggaaaaataaatctgcttatcgctaccacagtggcagaagaaggtctggatattaaagaa
tgtaacattgttatccgttatggtctcgtcaccaatgaaatagccatggtccaggcccgt
ggtcgagccagagctgatgagagcacctacgtcctggttgctcacagtggttcaggagtt
atcgaacatgagacagttaatgatttccgagagaagatgatgtataaagctatacattgt
gttcaaaatatgaaaccagaggagtatgctcataagattttggaattacagatgcaaagt
ataatggaaaagaaaatgaaaaccaagagaaatattgccaagcattacaagaataaccca
tcactaataactttcctttgcaaaaactgcagtgtgctagcctgttctggggaagatatc
catgtaattgagaaaatgcatcacgtcaatatgaccccagaattcaaggaactttacatt
gtaagagaaaacaaagcactgcaaaagaagtgtgccgactatcaaataaatggtgaaatc
atctgcaaatgtggccaggcttggggaacaatgatggtgcacaaaggcttagatttgcct
tgtctcaaaataaggaattttgtagtggttttcaaaaataattcaacaaagaaacaatac
aaaaagtgggtagaattacctatcacatttcccaatcttgactattcagaatgctgttta
tttagtgatgaggattag

DBGET integrated database retrieval system