KEGG   Homo sapiens (human): 64137Help
Entry
64137             CDS       T01001                                 

Gene name
ABCG4, WHITE2
Definition
ATP-binding cassette, sub-family G (WHITE), member 4
Orthology
K05680  
ATP-binding cassette, subfamily G (WHITE), member 4
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    64137 (ABCG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.3
AA seq 646 aa AA seqDB search
MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVD
IEFVELSYSVREGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRE
SGMKGQILVNGRPRELRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKEL
VTEILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVV
SLMKSLAQGGRTIICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCP
TYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDP
IESHTFATSTLTQFCILFKRTFLSILRDTVLTHLRFMSHVVIGVLIGLLYLHIGDDASKV
FNNTGCLFFSMLFLMFAALMPTVLTFPLEMAVFMREHLNYWYSLKAYYLAKTMADVPFQV
VCPVVYCSIVYWMTGQPAETSRFLLFSALATATALVAQSLGLLIGAASNSLQVATFVGPV
TAIPVLLFSGFFVSFKTIPTYLQWSSYLSYVRYGFEGVILTIYGMERGDLTCLEERCPFR
EPQSILRALDVEDAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaaggcgctggaggccgtgggctgtggactagggccgggggctgtggccatg
gccgtgacgctggaggacggggcggaaccccctgtgctgaccacgcacctgaagaaggtg
gagaaccacatcactgaagcccagcgcttctcccacctacccaagcgctcagccgtggac
atcgagttcgtggagctgtcctattccgtgcgggaggggccctgctggcgcaaaaggggt
tataagacccttctcaagtgcctctcaggtaaattctgccgccgggagctgattggcatc
atgggcccctcaggggctggcaagtctacattcatgaacatcttggcaggatacagggag
tctggaatgaaggggcagatcctggttaatggaaggccacgggagctgaggaccttccgc
aagatgtcctgctacatcatgcaagatgacatgctgctgccgcacctcacggtgttggaa
gccatgatggtctctgctaacctgaagctgagtgagaagcaggaggtgaagaaggagctg
gtgacagagatcctgacggcactgggcctgatgtcgtgctcccacacgaggacagccctg
ctctctggcgggcagaggaagcgtctggccatcgccctggagctggtcaacaacccgcct
gtcatgttctttgatgagcccaccagtggtctggatagcgcctcttgtttccaagtggtg
tccctcatgaagtccctggcacaggggggccgtaccatcatctgcaccatccaccagccc
agtgccaagctctttgagatgtttgacaagctctacatcctgagccagggtcagtgcatc
ttcaaaggcgtggtcaccaacctgatcccctatctaaagggactcggcttgcattgcccc
acctaccacaacccggctgacttcatcatcgaggtggcctctggcgagtatggagacctg
aaccccatgttgttcagggctgtgcagaatgggctgtgcgctatggctgagaagaagagc
agccctgagaagaacgaggtccctgccccatgccctccttgtcctccggaagtggatccc
attgaaagccacacctttgccaccagcaccctcacacagttctgcatcctcttcaagagg
accttcctgtccatcctcagggacacggtcctgacccacctacggttcatgtcccacgtg
gttattggcgtgctcatcggcctcctctacctgcatattggcgacgatgccagcaaggtc
ttcaacaacaccggctgcctcttcttctccatgctgttcctcatgttcgccgccctcatg
ccaactgtgctcaccttccccttagagatggcggtcttcatgagggagcacctcaactac
tggtacagcctcaaagcgtattacctggccaagaccatggctgacgtgccctttcaggtg
gtgtgtccggtggtctactgcagcattgtgtactggatgacgggccagcccgctgagacc
agccgcttcctgctcttctcagccctggccaccgccaccgccttggtggcccaatctttg
gggctgctgatcggagctgcttccaactccctacaggtggccacttttgtgggcccagtt
accgccatccctgtcctcttgttctccggcttctttgtcagcttcaagaccatccccact
tacctgcaatggagctcctatctctcctatgtcaggtatggctttgagggtgtgatcctg
acgatctatggcatggagcgaggagacctgacatgtttagaggaacgctgcccgttccgg
gagccacagagcatcctccgagcgctggatgtggaggatgccaagctctacatggacttc
ctggtcttgggcatcttcttcctagccctgcggctgctggcctaccttgtgctgcgttac
cgggtcaagtcagagagatag

DBGET integrated database retrieval system