KEGG   Homo sapiens (human): 641371Help
Entry
641371            CDS       T01001                                 

Gene name
ACOT1, ACH2, CTE-1, LACH2
Definition
acyl-CoA thioesterase 1 (EC:3.1.2.2)
Orthology
K01068  
acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    641371 (ACOT1)
   01040 Biosynthesis of unsaturated fatty acids
    641371 (ACOT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     641371 (ACOT1)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   641371 (ACOT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 421 aa AA seqDB search
MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGEL
DLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLL
CRVRHERYFLPPGVRREPVRAGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAG
KGFAVMALAYYNYEDLPKTMETLHLEYFEEAVNYLLSHPEVKGPGVGLLGISKGGELCLS
MASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPL
EGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGH
YIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSK
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacgctgatcctggagcccgcgggccgctgctgctgggacgaaccggtgcga
atcgccgtgcgcggcctagccccggagcagccggtcacgctgcgcgcgtccctgcgcgac
gagaagggcgcgcttttccaggcccacgcgcgctaccgcgccgacacccttggcgagctg
gacctggagcgcgcgcccgcgctgggcggcagcttcgcggggcttgagcccatggggctg
ctctgggccttggagcccgagaaacccttggtgcggctggtgaagcgcgacgtgcgaacg
cccttggccgtggagctggaggtgctggatggccacgaccccgaccccgggcggctgctg
tgccgggtgcggcacgagcgctacttcctcccgcccggggtgcggcgcgagccggtgcgc
gcgggccgggtgcgaggcacgctcttcctgccgccagaacctgggccctttcctggcatt
gtggacatgttcggaactggaggtggcctgctggagtatcgggctagtctgctggctggg
aagggttttgctgtgatggctctggcttactataactatgaagacctccccaagaccatg
gagacgctccatctggagtactttgaagaagctgtgaactacttgctcagtcatcctgag
gtaaaaggtccaggagttgggctgcttggaatttccaaagggggtgagctctgcctttcc
atggcctctttcctgaagggcatcacggctgctgtcgtcatcaacggctctgtggccaat
gttgggggaaccttacgctacaagggcgagaccctgccccctgtgggcgtcaacagaaat
cgcatcaaggtgaccaaagatggctatgcagacattgtggatgtcctgaacagccctttg
gaaggacctgaccagaagagcttcattcctgtggaaagggcagagagcaccttcctgttc
ctggtaggtcaggatgaccacaactggaagagtgagttctatgctaatgaggcctgtaaa
cgcttgcaggcccatgggaggagaaagccccagatcatctgttacccagagacagggcac
tatattgagcctccttacttccccctgtgtcgggcttccctgcatgccttggtgggcagt
cctattatctggggaggggagcccagggctcatgccatggctcaggtggatgcttggaaa
caactccagactttcttccacaaacacttgggtggccacgaggggacaatcccatcaaaa
gtgtaa

DBGET integrated database retrieval system