KEGG   Homo sapiens (human): 641371Help
Entry
641371            CDS       T01001                                 

Gene name
ACOT1, ACH2, CTE-1, LACH2
Definition
acyl-CoA thioesterase 1 (EC:3.1.2.2)
Orthology
K01068  
acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Class
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:hsa00062]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hsa01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 421 aa AA seqDB search
MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGEL
DLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLL
CRVRHERYFLPPGVRREPVRAGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAG
KGFAVMALAYYNYEDLPKTMETLHLEYFEEAVNYLLSHPEVKGPGVGLLGISKGGELCLS
MASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPL
EGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGH
YIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSK
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacgctgatcctggagcccgcgggccgctgctgctgggacgaaccggtgcga
atcgccgtgcgcggcctagccccggagcagccggtcacgctgcgcgcgtccctgcgcgac
gagaagggcgcgcttttccaggcccacgcgcgctaccgcgccgacacccttggcgagctg
gacctggagcgcgcgcccgcgctgggcggcagcttcgcggggcttgagcccatggggctg
ctctgggccttggagcccgagaaacccttggtgcggctggtgaagcgcgacgtgcgaacg
cccttggccgtggagctggaggtgctggatggccacgaccccgaccccgggcggctgctg
tgccgggtgcggcacgagcgctacttcctcccgcccggggtgcggcgcgagccggtgcgc
gcgggccgggtgcgaggcacgctcttcctgccgccagaacctgggccctttcctggcatt
gtggacatgttcggaactggaggtggcctgctggagtatcgggctagtctgctggctggg
aagggttttgctgtgatggctctggcttactataactatgaagacctccccaagaccatg
gagacgctccatctggagtactttgaagaagctgtgaactacttgctcagtcatcctgag
gtaaaaggtccaggagttgggctgcttggaatttccaaagggggtgagctctgcctttcc
atggcctctttcctgaagggcatcacggctgctgtcgtcatcaacggctctgtggccaat
gttgggggaaccttacgctacaagggcgagaccctgccccctgtgggcgtcaacagaaat
cgcatcaaggtgaccaaagatggctatgcagacattgtggatgtcctgaacagccctttg
gaaggacctgaccagaagagcttcattcctgtggaaagggcagagagcaccttcctgttc
ctggtaggtcaggatgaccacaactggaagagtgagttctatgctaatgaggcctgtaaa
cgcttgcaggcccatgggaggagaaagccccagatcatctgttacccagagacagggcac
tatattgagcctccttacttccccctgtgtcgggcttccctgcatgccttggtgggcagt
cctattatctggggaggggagcccagggctcatgccatggctcaggtggatgcttggaaa
caactccagactttcttccacaaacacttgggtggccacgaggggacaatcccatcaaaa
gtgtaa

DBGET integrated database retrieval system