KEGG   Homo sapiens (human): 6416Help
Entry
6416              CDS       T01001                                 

Gene name
MAP2K4, JNKK, JNKK1, MAPKK4, MEK4, MKK4, PRKMK4, SAPKK-1, SAPKK1, SEK1, SERK1, SKK1
Definition
mitogen-activated protein kinase kinase 4 (EC:2.7.12.2)
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p12
AA seq 410 aa AA seqDB search
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLNFA
NPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIG
RGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALF
REGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRD
IKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSD
VWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLT
KDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
cccggccccgtagggtccccggcgccaggccacccggccgtcagcagcatgcagggcttt
cagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaattttgca
aatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagttcaa
aacccacacatagagagactgagaacacacagcattgagtcatcaggaaaactgaagatc
tcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattgga
cgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatggca
gttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggatttg
gatgtagtaatgcggagtagtgattgcccatacattgttcagttttatggtgcactcttc
agagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttac
aaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcact
ttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacagagat
atcaaaccttccaatattcttctggacagaagtggaaatattaagctctgtgacttcggc
atcagtggacagcttgtggactctattgccaagacaagagatgctggctgtaggccatac
atggcacctgaaagaatagacccaagcgcatcacgacaaggatatgatgtccgctctgat
gtctggagtttggggatcacattgtatgagttggccacaggccgatttccttatccaaag
tggaatagtgtatttgatcaactaacacaagtcgtgaaaggagatcctccgcagctgagt
aattctgaggaaagggaattctccccgagtttcatcaactttgtcaacttgtgccttacg
aaggatgaatccaaaaggccaaagtataaagagcttctgaaacatccctttattttgatg
tatgaagaacgtgccgttgaggtcgcatgctatgtttgtaaaatcctggatcaaatgcca
gctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system