KEGG   Homo sapiens (human): 64170Help
Entry
64170             CDS       T01001                                 

Gene name
CARD9, CANDF2, hCARD9
Definition
caspase recruitment domain family, member 9
Orthology
K12794  
caspase recruitment domain-containing protein 9
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Tuberculosis
Disease
H01109  
Chronic mucocutaneous candidiasis (CMC)
Class
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.3
AA seq 536 aa AA seqDB search
MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLM
TEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKE
ENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLKHSLMKAEDDCKVERKHTLKLRHAMEQ
RPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYIQVLEEDWRQALRDHQEQANT
IFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQMEEVAIERDQA
IATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDA
GLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactacgagaacgatgacgagtgctggagcgtcctggagggcttccgggtgacg
ctcacctcggtcatcgacccctcacgcatcacaccttacctgcggcagtgcaaggtcctg
aaccccgatgatgaggagcaggtgctcagcgaccccaacctggtcatccgcaaacggaaa
gtgggtgtgctcctggacatcctgcagcggaccggccacaagggctacgtggccttcctc
gagagcctggagctctactacccgcagctgtacaagaaggtcacaggcaaggagccggcc
cgcgtcttctccatgatcatcgacgcgtccggggagtcaggcctgactcagctgctgatg
actgaggtcatgaagctgcagaagaaggtgcaggacctgaccgcgctgctgagctccaaa
gatgacttcatcaaggagctgcgggtgaaggacagcctgctgcgcaagcaccaggagcgt
gtgcagaggctcaaggaggagtgcgaggccggcagccgcgagctcaagcgctgcaaggag
gagaactacgacctggccatgcgcctggcgcaccagagtgaggagaagggcgccgcgctc
atgcggaaccgtgacctgcagctggagattgaccagctcaagcacagcctcatgaaggcc
gaggacgactgcaaggtggagcgcaagcacacgctgaagctcaggcacgccatggagcag
cggcccagccaggagctgctgtgggagctgcagcaggagaaggccctgctccaggcccgg
gtgcaggagctggaggcctccgtccaggaggggaagctggacaggagcagcccctacatc
caggtactggaggaggactggcggcaggcgctgcgggaccaccaggagcaggccaacacc
atcttctccctgcgcaaggacctccgccagggcgaggcccgacgcctccggtgcatggag
gagaaggagatgttcgagctgcagtgcctggcactacgtaaggactccaagatgtacaag
gaccgcatcgaggccatcctgctgcagatggaggaggtcgccattgagcgggaccaggcc
atagccacgcgggaggagctgcacgcacagcacgcccggggcctgcaggagaaggacgcg
ctgcgcaagcaggtgcgggagctgggcgagaaggcggatgagctgcagctgcaggtgttc
cagtgtgaggcgcagctactggccgtggagggcaggctcaggcggcagcagctggagacg
ctcgtcctgagctccgacctggaagatggctcacccaggaggtcccaggagctctcactc
ccccaggacctggaggacacccagctctcagacaaaggctgccttgccggcggggggagc
ccgaaacagccctttgcagctctgcaccaggagcaggttttgcggaacccccatgacgca
ggcctgagcagcggggagccgcccgagaaggagcggcggcgcctcaaagagagttttgag
aactaccgcaggaagcgcgccctcaggaagatgcagaaaggatggcggcagggggaggag
gaccgggagaacaccacgggcagcgacaacaccgacactgagggctcctag

DBGET integrated database retrieval system