KEGG   Homo sapiens (human): 64170Help
Entry
64170             CDS       T01001                                 

Gene name
CARD9, CANDF2, hCARD9
Definition
(RefSeq) caspase recruitment domain family member 9
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05152  Tuberculosis
Disease
H01109  Chronic mucocutaneous candidiasis (CMC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    64170 (CARD9)
   04625 C-type lectin receptor signaling pathway
    64170 (CARD9)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    64170 (CARD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2
Motif
Other DBs
NCBI-GeneID: 64170
NCBI-ProteinID: NP_434700
OMIM: 607212
HGNC: 16391
Ensembl: ENSG00000187796
Vega: OTTHUMG00000020925
Pharos: Q9H257(Tbio)
UniProt: Q9H257 A0A024R8F1
Position
9q34.3
AA seq 536 aa AA seqDB search
MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLM
TEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKE
ENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLKHSLMKAEDDCKVERKHTLKLRHAMEQ
RPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYIQVLEEDWRQALRDHQEQANT
IFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQMEEVAIERDQA
IATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDA
GLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactacgagaacgatgacgagtgctggagcgtcctggagggcttccgggtgacg
ctcacctcggtcatcgacccctcacgcatcacaccttacctgcggcagtgcaaggtcctg
aaccccgatgatgaggagcaggtgctcagcgaccccaacctggtcatccgcaaacggaaa
gtgggtgtgctcctggacatcctgcagcggaccggccacaagggctacgtggccttcctc
gagagcctggagctctactacccgcagctgtacaagaaggtcacaggcaaggagccggcc
cgcgtcttctccatgatcatcgacgcgtccggggagtcaggcctgactcagctgctgatg
actgaggtcatgaagctgcagaagaaggtgcaggacctgaccgcgctgctgagctccaaa
gatgacttcatcaaggagctgcgggtgaaggacagcctgctgcgcaagcaccaggagcgt
gtgcagaggctcaaggaggagtgcgaggccggcagccgcgagctcaagcgctgcaaggag
gagaactacgacctggccatgcgcctggcgcaccagagtgaggagaagggcgccgcgctc
atgcggaaccgtgacctgcagctggagattgaccagctcaagcacagcctcatgaaggcc
gaggacgactgcaaggtggagcgcaagcacacgctgaagctcaggcacgccatggagcag
cggcccagccaggagctgctgtgggagctgcagcaggagaaggccctgctccaggcccgg
gtgcaggagctggaggcctccgtccaggaggggaagctggacaggagcagcccctacatc
caggtactggaggaggactggcggcaggcgctgcgggaccaccaggagcaggccaacacc
atcttctccctgcgcaaggacctccgccagggcgaggcccgacgcctccggtgcatggag
gagaaggagatgttcgagctgcagtgcctggcactacgtaaggactccaagatgtacaag
gaccgcatcgaggccatcctgctgcagatggaggaggtcgccattgagcgggaccaggcc
atagccacgcgggaggagctgcacgcacagcacgcccggggcctgcaggagaaggacgcg
ctgcgcaagcaggtgcgggagctgggcgagaaggcggatgagctgcagctgcaggtgttc
cagtgtgaggcgcagctactggccgtggagggcaggctcaggcggcagcagctggagacg
ctcgtcctgagctccgacctggaagatggctcacccaggaggtcccaggagctctcactc
ccccaggacctggaggacacccagctctcagacaaaggctgccttgccggcggggggagc
ccgaaacagccctttgcagctctgcaccaggagcaggttttgcggaacccccatgacgca
ggcctgagcagcggggagccgcccgagaaggagcggcggcgcctcaaagagagttttgag
aactaccgcaggaagcgcgccctcaggaagatgcagaaaggatggcggcagggggaggag
gaccgggagaacaccacgggcagcgacaacaccgacactgagggctcctag

DBGET integrated database retrieval system