KEGG   Homo sapiens (human): 64218Help
Entry
64218             CDS       T01001                                 

Gene name
SEMA4A, CORD10, RP35, SEMAB, SEMB
Definition
(RefSeq) semaphorin 4A
  KO
K06521  
semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Disease
H00481  
Cone-rod dystrophy and cone dystrophy
H00527  
Retinitis pigmentosa (RP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    64218 (SEMA4A)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRP2; neuropilin 2 [KO:K06819]
   64218 (SEMA4A)
  PLXNA; plexin A [KO:K06820]
   64218 (SEMA4A)
  PLXNB; plexin B [KO:K06821]
   64218 (SEMA4A)
Cellular antigens [BR:hsa04090]
 Proteins
  64218 (SEMA4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q22
AA seq 761 aa AA seqDB search
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGA
VFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMER
GNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREH
VKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALIILVASPLRALRARGKVQGCE
TLRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTEVA
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggccctcccagccctgggcctggacccctggagcctcctgggccttttcctcttccaa
ctgcttcagctgctgctgccgacgacgaccgcggggggaggcgggcaggggcccatgccc
agggtcagatactatgcaggggatgaacgtagggcacttagcttcttccaccagaagggc
ctccaggattttgacactctgctcctgagtggtgatggaaatactctctacgtgggggct
cgagaagccattctggccttggatatccaggatccaggggtccccaggctaaagaacatg
ataccgtggccagccagtgacagaaaaaagagtgaatgtgcctttaagaagaagagcaat
gagacacagtgtttcaacttcatccgtgtcctggtttcttacaatgtcacccatctctac
acctgcggcaccttcgccttcagccctgcttgtaccttcattgaacttcaagattcctac
ctgttgcccatctcggaggacaaggtcatggagggaaaaggccaaagcccctttgacccc
gctcacaagcatacggctgtcttggtggatgggatgctctattctggtactatgaacaac
ttcctgggcagtgagcccatcctgatgcgcacactgggatcccagcctgtcctcaagacc
gacaacttcctccgctggctgcatcatgacgcctcctttgtggcagccatcccttcgacc
caggtcgtctacttcttcttcgaggagacagccagcgagtttgacttctttgagaggctc
cacacatcgcgggtggctagagtctgcaagaatgacgtgggcggcgaaaagctgctgcag
aagaagtggaccaccttcctgaaggcccagctgctctgcacccagccggggcagctgccc
ttcaacgtcatccgccacgcggtcctgctccccgccgattctcccacagctccccacatc
tacgcagtcttcacctcccagtggcaggttggcgggaccaggagctctgcggtttgtgcc
ttctctctcttggacattgaacgtgtctttaaggggaaatacaaagagttgaacaaagaa
acttcacgctggactacttataggggccctgagaccaacccccggccaggcagttgctca
gtgggcccctcctctgataaggccctgaccttcatgaaggaccatttcctgatggatgag
caagtggtggggacgcccctgctggtgaaatctggcgtggagtatacacggcttgcagtg
gagacagcccagggccttgatgggcacagccatcttgtcatgtacctgggaaccaccaca
gggtcgctccacaaggctgtggtaagtggggacagcagtgctcatctggtggaagagatt
cagctgttccctgaccctgaacctgttcgcaacctgcagctggcccccacccagggtgca
gtgtttgtaggcttctcaggaggtgtctggagggtgccccgagccaactgtagtgtctat
gagagctgtgtggactgtgtccttgcccgggacccccactgtgcctgggaccctgagtcc
cgaacctgttgcctcctgtctgcccccaacctgaactcctggaagcaggacatggagcgg
gggaacccagagtgggcatgtgccagtggccccatgagcaggagccttcggcctcagagc
cgcccgcaaatcattaaagaagtcctggctgtccccaactccatcctggagctcccctgc
ccccacctgtcagccttggcctcttattattggagtcatggcccagcagcagtcccagaa
gcctcttccactgtctacaatggctccctcttgctgatagtgcaggatggagttgggggt
ctctaccagtgctgggcaactgagaatggcttttcataccctgtgatctcctactgggtg
gacagccaggaccagaccctggccctggatcctgaactggcaggcatcccccgggagcat
gtgaaggtcccgttgaccagggtcagtggtggggccgccctggctgcccagcagtcctac
tggccccactttgtcactgtcactgtcctctttgccttagtgctttcaggagccctcatc
atcctcgtggcctccccattgagagcactccgggctcggggcaaggttcagggctgtgag
accctgcgccctggggagaaggccccgttaagcagagagcaacacctccagtctcccaag
gaatgcaggacctctgccagtgatgtggacgctgacaacaactgcctaggcactgaggta
gcttaa

DBGET integrated database retrieval system