KEGG   Homo sapiens (human): 64218Help
Entry
64218             CDS       T01001                                 

Gene name
SEMA4A, CORD10, RP35, SEMAB, SEMB
Definition
(RefSeq) sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
  KO
K06521  
semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Disease
H00481  
Cone-rod dystrophy and cone dystrophy
H00527  
Retinitis pigmentosa (RP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    64218 (SEMA4A)
Cellular antigens [BR:hsa04090]
 Proteins
  64218 (SEMA4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q22
AA seq 761 aa AA seqDB search
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGA
VFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMER
GNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREH
VKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALIILVASPLRALRARGKVQGCE
TLRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTEVA
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggccctcccagccctgggcctggacccctggagcctcctgggccttttcctcttccaa
ctgcttcagctgctgctgccgacgacgaccgcggggggaggcgggcaggggcccatgccc
agggtcagatactatgcaggggatgaacgtagggcacttagcttcttccaccagaagggc
ctccaggattttgacactctgctcctgagtggtgatggaaatactctctacgtgggggct
cgagaagccattctggccttggatatccaggatccaggggtccccaggctaaagaacatg
ataccgtggccagccagtgacagaaaaaagagtgaatgtgcctttaagaagaagagcaat
gagacacagtgtttcaacttcatccgtgtcctggtttcttacaatgtcacccatctctac
acctgcggcaccttcgccttcagccctgcttgtaccttcattgaacttcaagattcctac
ctgttgcccatctcggaggacaaggtcatggagggaaaaggccaaagcccctttgacccc
gctcacaagcatacggctgtcttggtggatgggatgctctattctggtactatgaacaac
ttcctgggcagtgagcccatcctgatgcgcacactgggatcccagcctgtcctcaagacc
gacaacttcctccgctggctgcatcatgacgcctcctttgtggcagccatcccttcgacc
caggtcgtctacttcttcttcgaggagacagccagcgagtttgacttctttgagaggctc
cacacatcgcgggtggctagagtctgcaagaatgacgtgggcggcgaaaagctgctgcag
aagaagtggaccaccttcctgaaggcccagctgctctgcacccagccggggcagctgccc
ttcaacgtcatccgccacgcggtcctgctccccgccgattctcccacagctccccacatc
tacgcagtcttcacctcccagtggcaggttggcgggaccaggagctctgcggtttgtgcc
ttctctctcttggacattgaacgtgtctttaaggggaaatacaaagagttgaacaaagaa
acttcacgctggactacttataggggccctgagaccaacccccggccaggcagttgctca
gtgggcccctcctctgataaggccctgaccttcatgaaggaccatttcctgatggatgag
caagtggtggggacgcccctgctggtgaaatctggcgtggagtatacacggcttgcagtg
gagacagcccagggccttgatgggcacagccatcttgtcatgtacctgggaaccaccaca
gggtcgctccacaaggctgtggtaagtggggacagcagtgctcatctggtggaagagatt
cagctgttccctgaccctgaacctgttcgcaacctgcagctggcccccacccagggtgca
gtgtttgtaggcttctcaggaggtgtctggagggtgccccgagccaactgtagtgtctat
gagagctgtgtggactgtgtccttgcccgggacccccactgtgcctgggaccctgagtcc
cgaacctgttgcctcctgtctgcccccaacctgaactcctggaagcaggacatggagcgg
gggaacccagagtgggcatgtgccagtggccccatgagcaggagccttcggcctcagagc
cgcccgcaaatcattaaagaagtcctggctgtccccaactccatcctggagctcccctgc
ccccacctgtcagccttggcctcttattattggagtcatggcccagcagcagtcccagaa
gcctcttccactgtctacaatggctccctcttgctgatagtgcaggatggagttgggggt
ctctaccagtgctgggcaactgagaatggcttttcataccctgtgatctcctactgggtg
gacagccaggaccagaccctggccctggatcctgaactggcaggcatcccccgggagcat
gtgaaggtcccgttgaccagggtcagtggtggggccgccctggctgcccagcagtcctac
tggccccactttgtcactgtcactgtcctctttgccttagtgctttcaggagccctcatc
atcctcgtggcctccccattgagagcactccgggctcggggcaaggttcagggctgtgag
accctgcgccctggggagaaggccccgttaagcagagagcaacacctccagtctcccaag
gaatgcaggacctctgccagtgatgtggacgctgacaacaactgcctaggcactgaggta
gcttaa

DBGET integrated database retrieval system