KEGG   Homo sapiens (human): 64223Help
Entry
64223             CDS       T01001                                 

Gene name
MLST8, GBL, GbetaL, LST8, POP3, WAT1
Definition
(RefSeq) MTOR associated protein, LST8 homolog
  KO
K08266  
target of rapamycin complex subunit LST8
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    64223 (MLST8)
   04150 mTOR signaling pathway
    64223 (MLST8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 326 aa AA seqDB search
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctccccaggcacggtgggcagtgacccggtcatcctggccactgcaggctac
gaccacaccgtgcgcttctggcaggcccacagcggcatctgcacccggacggtgcagcac
caggactcccaggtgaatgccttggaggtcacaccggaccgcagcatgattgctgctgca
ggttaccagcacatccgcatgtatgatctcaactccaataaccctaaccccatcatcagc
tacgacggcgtcaacaagaacatcgcgtctgtgggcttccacgaagacggccgctggatg
tacacgggcggcgaggactgcacagccaggatctgggacctcaggtcccggaacctgcag
tgccagcggatcttccaggtgaacgcacccattaactgcgtgtgcctgcaccccaaccag
gcagagctcatcgtgggtgaccagagcggggctatccacatctgggacttgaaaacagac
cacaacgagcagctgatccctgagcccgaggtctccatcacgtccgcccacatcgatccc
gacgccagctacatggcagctgtcaatagcaccggaaactgctatgtctggaatctgacg
gggggcattggtgacgaggtgacccagctcatccccaagactaagatccctgcccacacg
cgctacgccctgcagtgtcgcttcagccccgactccacgctcctcgccacctgctcggct
gatcagacgtgcaagatctggaggacgtccaacttctccctgatgacggagctgagcatc
aagagcggcaaccccggggagtcctcccgcggctggatgtggggctgcgccttctcgggg
gactcccagtacatcgtcactgcttcctcggacaacctggcccggctctggtgtgtggag
actggagagatcaagagagagtatggcggccaccagaaggctgttgtctgcctggccttc
aatgacagtgtgctgggctag

DBGET integrated database retrieval system