KEGG   Homo sapiens (human): 64223Help
Entry
64223             CDS       T01001                                 

Gene name
MLST8, GBL, GbetaL, LST8, POP3, WAT1
Definition
MTOR associated protein, LST8 homolog (S. cerevisiae)
Orthology
K08266  
G protein beta subunit-like
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    64223 (MLST8)
   04150 mTOR signaling pathway
    64223 (MLST8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 326 aa AA seqDB search
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctccccaggcacggtgggcagtgacccggtcatcctggccactgcaggctac
gaccacaccgtgcgcttctggcaggcccacagcggcatctgcacccggacggtgcagcac
caggactcccaggtgaatgccttggaggtcacaccggaccgcagcatgattgctgctgca
ggttaccagcacatccgcatgtatgatctcaactccaataaccctaaccccatcatcagc
tacgacggcgtcaacaagaacatcgcgtctgtgggcttccacgaagacggccgctggatg
tacacgggcggcgaggactgcacagccaggatctgggacctcaggtcccggaacctgcag
tgccagcggatcttccaggtgaacgcacccattaactgcgtgtgcctgcaccccaaccag
gcagagctcatcgtgggtgaccagagcggggctatccacatctgggacttgaaaacagac
cacaacgagcagctgatccctgagcccgaggtctccatcacgtccgcccacatcgatccc
gacgccagctacatggcagctgtcaatagcaccggaaactgctatgtctggaatctgacg
gggggcattggtgacgaggtgacccagctcatccccaagactaagatccctgcccacacg
cgctacgccctgcagtgtcgcttcagccccgactccacgctcctcgccacctgctcggct
gatcagacgtgcaagatctggaggacgtccaacttctccctgatgacggagctgagcatc
aagagcggcaaccccggggagtcctcccgcggctggatgtggggctgcgccttctcgggg
gactcccagtacatcgtcactgcttcctcggacaacctggcccggctctggtgtgtggag
actggagagatcaagagagagtatggcggccaccagaaggctgttgtctgcctggccttc
aatgacagtgtgctgggctag

DBGET integrated database retrieval system