KEGG   Homo sapiens (human): 64225Help
Entry
64225             CDS       T01001                                 

Gene name
ATL2, ARL3IP2, ARL6IP2, atlastin2
Definition
(RefSeq) atlastin GTPase 2
  KO
K17339  
atlastin [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     64225 (ATL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p22.3
AA seq 583 aa AA seqDB search
MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCP
VQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYN
KDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDS
QSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLM
FLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPG
LKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYI
KIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLD
LKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFA
VMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAET
LWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggggacgaggcagcgcgagggcagcaaccgcaccaggggctgtggcgccgg
cgacggaccagcgacccaagcgccgcggttaaccacgtctcgtccacgacctccctaggt
gagaattatgaagatgatgacctagtaaattctgatgaggttatgaagaaaccatgtcca
gtacagattgttcttgctcatgaagatgaccataactttgaacttgatgaagaagctttg
gagcagatattgctacaggagcacatacgagatcttaacatagtagtggtatctgtggca
ggagcttttcgtaaagggaagtcatttctactggacttcatgcttagatacatgtataac
aaggattctcaaagttggattggtggaaacaatgaaccattgacaggctttacatggcga
ggtggctgtgaaagagaaacaacaggcatacaagtttggaatgaagtatttgtgattgac
agacctaatggaactaaagttgctgtgctgcttatggatacccagggtgcctttgatagc
cagtcaactatcaaagactgtgcaacggtgtttgctctgagcactatgactagctctgtc
caggtatataatctgtctcagaatattcaagaagatgatcttcaacatttgcaattattt
acagagtatggaagacttgcgatggaagaaatctaccagaaaccatttcagacattaatg
tttttgattcgagattggagctatccttatgaacattcatatggtttggaaggtggaaag
caatttcttgaaaagagattacaggtaaaacaaaatcaacatgaagagcttcagaatgta
aggaagcacatacacaattgtttctcaaatcttggttgcttccttttgccacatcctggt
cttaaagttgcaactaatcctagttttgatgggagattgaaagatattgatgaagacttt
aaacgagagcttcgaaatctggttccattgctgcttgcccctgaaaatttggtagaaaaa
gagataagtggatctaaagtcacttgtagagatcttgtagaatattttaaggcttacatc
aaaatctatcaaggagaagaacttccacatccaaagtccatgcttcaggcaacagctgaa
gctaataatcttgctgcagtagcaggagcaagagatacctattgtaaaagtatggaacag
gtatgtggaggggacaagccttacattgcaccttcagatctggagcgaaaacacttggat
ctcaaggaagtggcgataaaacaatttcgttcagtaaaaaagatgggtggagatgagttc
tgccgtcgttatcaggaccagcttgaagctgaaattgaagaaacctatgcaaattttata
aagcacaatgatggcaaaaatatcttctatgctgctcgtaccccagccacactgtttgcg
gtcatgtttgctatgtatataatctcaggactgactggcttcattggcctaaactctata
gctgtcttgtgtaaccttgtcatggggttagcactgatatttctttgtacttgggcatat
gttaaatactctggggagttcagagaaattggaacagtgattgatcagattgctgaaaca
ctatgggaacaggtattgaagcccctgggtgataatttgatggaggaaaacataaggcag
tctgtaacaaactctatcaaagcaggcctgactgaccaggtgtctcatcatgccagatta
aagacagactga

DBGET integrated database retrieval system