KEGG   Homo sapiens (human): 6425Help
Entry
6425              CDS       T01001                                 

Gene name
SFRP5, SARP3
Definition
secreted frizzled-related protein 5
Orthology
K02222  
secreted frizzled-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6425 (SFRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24.1
AA seq 317 aa AA seqDB search
MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADL
PLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRP
IYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKI
CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDT
KRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
YPCSLYYPFFYGAAEPH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcggcggcggcgggggggggcgtgcggacggccgcgctggcgctgctgctgggg
gcgctgcactgggcgccggcgcgctgcgaggagtacgactactatggctggcaggccgag
ccgctgcacggccgctcctactccaagccgccgcagtgccttgacatccctgccgacctg
ccgctctgccacacggtgggctacaagcgcatgcggctgcccaacctgctggagcacgag
agcctggccgaagtgaagcagcaggcgagcagctggctgccgctgctggccaagcgctgc
cactcggatacgcaggtcttcctgtgctcgctctttgcgcccgtctgtctcgaccggccc
atctacccgtgccgctcgctgtgcgaggccgtgcgcgccggctgcgcgccgctcatggag
gcctacggcttcccctggcctgagatgctgcactgccacaagttccccctggacaacgac
ctctgcatcgccgtgcagttcgggcacctgcccgccaccgcgcctccagtgaccaagatc
tgcgcccagtgtgagatggagcacagtgctgacggcctcatggagcagatgtgctccagt
gactttgtggtcaaaatgcgcatcaaggagatcaagatagagaatggggaccggaagctg
attggagcccagaaaaagaagaagctgctcaagccgggccccctgaagcgcaaggacacc
aagcggctggtgctgcacatgaagaatggcgcgggctgcccctgcccacagctggacagc
ctggcgggcagcttcctggtcatgggccgcaaagtggatggacagctgctgctcatggcc
gtctaccgctgggacaagaagaataaggagatgaagtttgcagtcaaattcatgttctcc
tacccctgctccctctactaccctttcttctacggggcggcagagccccactga

DBGET integrated database retrieval system