KEGG   Homo sapiens (human): 6431Help
Entry
6431              CDS       T01001                                 

Gene name
SRSF6, B52, HEL-S-91, SFRS6, SRP55
Definition
serine/arginine-rich splicing factor 6
Orthology
K12893  
splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6431 (SRSF6)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6431 (SRSF6)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6431 (SRSF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q12-q13.1
AA seq 344 aa AA seqDB search
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKEL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSR
CSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIE
DKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKG
RKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR
SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgtctacataggacgcctgagctacaacgtccgggagaaggacatccagcgc
tttttcagtggctatggccgcctcctcgaagtagacctcaaaaatgggtacggcttcgtg
gagttcgaggactcccgcgacgccgacgacgccgtttacgagctgaacggcaaggagctc
tgcggcgagcgcgtgatcgtagagcacgcccggggcccgcgtcgcgatcgcgacggctac
agctacggaagccgcagtggtggaggtggatacagcagtcggagaacatctggcagagac
aaatacggaccacctgttcgtacagaatacaggcttattgtagaaaatctttctagtcgg
tgcagttggcaagatttaaaggattttatgcgacaagcaggtgaagtaacctatgcggat
gcccacaaggaacgaacaaatgagggtgtaattgagtttcgctcctactctgacatgaag
cgtgctttggacaaactggatggcacagaaataaatggcagaaatattaggcttattgaa
gataagccacgcacaagccataggcgatcttactctggaagcagatccaggtctcgatct
agaagacggtcacgaagtaggagtcgcaggagcagccgcagtagatctcgaagtatctca
aaaagtcgctcccgttccaggtcgcggagcaaaggtcgatcacgttctcgatcaaaaggc
aggaaatctagatcaaagagcaaatctaagcccaagtctgatcggggctcccattcacat
tctcgaagcagatctaaggatgagtatgagaaatctcgaagcaggtctcggtcccgatcc
cctaaagaaaatggaaagggtgatataaagtcaaaatccagatcaaggagccagtcccgt
tccaattcgccgctacctgttccaccctcaaaggcccgttctgtgtcccctccaccaaaa
agagctacttcaagatcccgttctagatctcgctcaaagtcaagatcaaggtccaggtcg
agttccagagattaa

DBGET integrated database retrieval system