KEGG   Homo sapiens (human): 64326Help
Entry
64326             CDS       T01001                                 

Gene name
RFWD2, COP1, RNF200
Definition
(RefSeq) ring finger and WD repeat domain 2
  KO
K10143  
E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64326 (RFWD2)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    64326 (RFWD2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     64326 (RFWD2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    64326 (RFWD2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     64326 (RFWD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25.1-q25.2
AA seq 731 aa AA seqDB search
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGG
LGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLC
NGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNI
DHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNL
MLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMS
GLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRL
TAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSS
YHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKL
WSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRK
AVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSE
NNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAAN
SQGTIKVLELV
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtagccgccaggccgggtcgggctccgctgggacaagccccgggtcctcggcg
gcctcctcggtgacttccgcctcctcgtctttatcctcttccccgtcgccgccttccgtg
gcggtttcggcggcagcgctggtgtccggcggggtggcccaggccgccggctcgggcggc
ctcgggggcccggtgcggcctgtgttggtggcgcccgccgtatcgggtagcggcggcggg
gcggtgtccacgggcctgtcccggcacagctgcgcggccaggcccagcgccggcgtagga
ggcagcagctccagcctaggcagcggcagcaggaagcgacctctcctcgcccccctctgc
aacgggctcatcaactcctacgaggacaaaagcaacgacttcgtatgccccatctgcttt
gatatgattgaagaagcatacatgacaaaatgtggccacagcttttgctacaagtgtatt
catcagagtttggaggacaataatagatgtcccaagtgtaactatgttgtggacaatatt
gaccatctgtatcctaatttcttggtgaatgaactcattcttaaacagaagcaaagattt
gaggaaaagaggttcaaattggaccactcagtgagtagcaccaatggccacaggtggcag
atatttcaagattggttgggaactgaccaagataaccttgatttggccaatgtcaatctt
atgttggagttactagtgcagaagaagaaacaactggaagcagaatcacatgcagcccaa
ctacagattcttatggaattcctcaaggttgcaagaagaaataagagagagcaactggaa
cagatccagaaggagctaagtgttttggaagaggatattaagagagtggaagaaatgagt
ggcttatactctcctgtcagtgaggatagcacagtgcctcaatttgaagctccttctcca
tcacacagtagtattattgattccacagaatacagccaacctccaggtttcagtggcagt
tctcagacaaagaaacagccttggtataatagcacgttagcatcaagacgaaaacgactt
actgctcattttgaagacttggagcagtgttacttttctacaaggatgtctcgtatctca
gatgacagtcgaactgcaagccagttggatgaatttcaggaatgcttgtccaagtttact
cgatataattcagtacgacctttagccacattgtcatatgctagtgatctctataatggt
tccagtatagtctctagtattgaatttgaccgggattgtgactattttgcgattgctgga
gttacaaagaagattaaagtctatgaatatgacactgtcatccaggatgcagtggatatt
cattaccctgagaatgaaatgacctgcaattcgaaaatcagctgtatcagttggagtagt
taccataagaacctgttagctagcagtgattatgaaggcactgttattttatgggatgga
ttcacaggacagaggtcaaaggtctatcaggagcatgagaagaggtgttggagtgttgac
tttaatttgatggatcctaaactcttggcttcaggttctgatgatgcaaaagtgaagctg
tggtctaccaatctagacaactcagtggcaagcattgaggcaaaggctaatgtgtgctgt
gttaaattcagcccctcttccagataccatttggctttcggctgtgcagatcactgtgtc
cactactatgatcttcgtaacactaaacagccaatcatggtattcaaaggacaccgtaaa
gcagtctcttatgcaaagtttgtgagtggtgaggaaattgtctctgcctcaacagacagt
cagctaaaactgtggaatgtagggaaaccatactgcctacgttccttcaagggtcatatc
aatgaaaaaaactttgtaggcctggcttccaatggagattatatagcttgtggaagtgaa
aataactctctctacctgtactataaaggactttctaagactttgctaacttttaagttt
gatacagtcaaaagtgttctcgacaaagaccgaaaagaagatgatacaaatgaatttgtt
agtgctgtgtgctggagggcactaccagatggggagtccaatgtgctgattgctgctaac
agtcagggtacaattaaggtgctagaattggtatga

DBGET integrated database retrieval system