KEGG   Homo sapiens (human): 64326Help
Entry
64326             CDS       T01001                                 

Gene name
RFWD2, COP1, RNF200
Definition
ring finger and WD repeat domain 2, E3 ubiquitin protein ligase
Orthology
K10143  
E3 ubiquitin-protein ligase RFWD2 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64326 (RFWD2)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    64326 (RFWD2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     64326 (RFWD2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul4 complex
    target recognizing subunit (DCAF)
     64326 (RFWD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.1-q25.2
AA seq 707 aa AA seqDB search
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGG
LGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLC
NGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNI
DHLYPNFLVNELILKQKQRFEEKRFKLDHSNGHRWQIFQDWLGTDQDNLDLANVNLMLEL
LVQKKKQLEAESHAAQLQILMEFLKVARRNKREEMSGLYSPVSEDSTVPQFEAPSPSHSS
IIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSR
TASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKK
IKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQ
RSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFS
PSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKL
WNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVK
SVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtagccgccaggccgggtcgggctccgctgggacaagccccgggtcctcggcg
gcctcctcggtgacttccgcctcctcgtctttatcctcttccccgtcgccgccttccgtg
gcggtttcggcggcagcgctggtgtccggcggggtggcccaggccgccggctcgggcggc
ctcgggggcccggtgcggcctgtgttggtggcgcccgccgtatcgggtagcggcggcggg
gcggtgtccacgggcctgtcccggcacagctgcgcggccaggcccagcgccggcgtagga
ggcagcagctccagcctaggcagcggcagcaggaagcgacctctcctcgcccccctctgc
aacgggctcatcaactcctacgaggacaaaagcaacgacttcgtatgccccatctgcttt
gatatgattgaagaagcatacatgacaaaatgtggccacagcttttgctacaagtgtatt
catcagagtttggaggacaataatagatgtcccaagtgtaactatgttgtggacaatatt
gaccatctgtatcctaatttcttggtgaatgaactcattcttaaacagaagcaaagattt
gaggaaaagaggttcaaattggaccactcaaatggccacaggtggcagatatttcaagat
tggttgggaactgaccaagataaccttgatttggccaatgtcaatcttatgttggagtta
ctagtgcagaagaagaaacaactggaagcagaatcacatgcagcccaactacagattctt
atggaattcctcaaggttgcaagaagaaataagagagaggaaatgagtggcttatactct
cctgtcagtgaggatagcacagtgcctcaatttgaagctccttctccatcacacagtagt
attattgattccacagaatacagccaacctccaggtttcagtggcagttctcagacaaag
aaacagccttggtataatagcacgttagcatcaagacgaaaacgacttactgctcatttt
gaagacttggagcagtgttacttttctacaaggatgtctcgtatctcagatgacagtcga
actgcaagccagttggatgaatttcaggaatgcttgtccaagtttactcgatataattca
gtacgacctttagccacattgtcatatgctagtgatctctataatggttccagtatagtc
tctagtattgaatttgaccgggattgtgactattttgcgattgctggagttacaaagaag
attaaagtctatgaatatgacactgtcatccaggatgcagtggatattcattaccctgag
aatgaaatgacctgcaattcgaaaatcagctgtatcagttggagtagttaccataagaac
ctgttagctagcagtgattatgaaggcactgttattttatgggatggattcacaggacag
aggtcaaaggtctatcaggagcatgagaagaggtgttggagtgttgactttaatttgatg
gatcctaaactcttggcttcaggttctgatgatgcaaaagtgaagctgtggtctaccaat
ctagacaactcagtggcaagcattgaggcaaaggctaatgtgtgctgtgttaaattcagc
ccctcttccagataccatttggctttcggctgtgcagatcactgtgtccactactatgat
cttcgtaacactaaacagccaatcatggtattcaaaggacaccgtaaagcagtctcttat
gcaaagtttgtgagtggtgaggaaattgtctctgcctcaacagacagtcagctaaaactg
tggaatgtagggaaaccatactgcctacgttccttcaagggtcatatcaatgaaaaaaac
tttgtaggcctggcttccaatggagattatatagcttgtggaagtgaaaataactctctc
tacctgtactataaaggactttctaagactttgctaacttttaagtttgatacagtcaaa
agtgttctcgacaaagaccgaaaagaagatgatacaaatgaatttgttagtgctgtgtgc
tggagggcactaccagatggggagtccaatgtgctgattgctgctaacagtcagggtaca
attaaggtgctagaattggtatga

DBGET integrated database retrieval system