KEGG   Homo sapiens (human): 64332Help
Entry
64332             CDS       T01001                                 

Gene name
NFKBIZ, IKBZ, INAP, MAIL
Definition
(RefSeq) NFKB inhibitor zeta
  KO
K14242  
NF-kappa-B inhibitor zeta
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    64332 (NFKBIZ)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    64332 (NFKBIZ)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   64332 (NFKBIZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BYH8(Tbio)
UniProt: 
Position
3q12.3
AA seq 718 aa AA seqDB search
MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAP
GSPGSDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSV
KELLLHIRSHKQKASGQAVDDFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRP
ALLHSQFLTPPQTPTPGESMEDVHLNEPKQESSADLLQNIINIKNECSPVSLNTVQVSWL
NPVVVPQSSPAEQCQDFHGGQVFSPPQKCQPFQVRGSQQMIDQASLYQYSPQNQHVEQQP
HYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPMQTS
SSVQQQNDAHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQW
QVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNG
QSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSN
QFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQ
MGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQ
YRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgattgtggacaagctgctggacgacagccgcggcggagaggggctgcgggacgcggcg
ggcggctgcggcctcatgaccagcccgctcaacctgagctacttctacggcgcgtcgccg
cccgccgccgccccgggcgcctgcgacgccagctgctcggtcttgggcccctcggcgccc
ggctcgcccggctccgactcctccgacttctcctctgcctcgtcggtgtcctcctgcggc
gccgtggagtcccggtcgagaggcggcgcccgcgccgagcgccagccagttgagccccat
atgggggttggcaggcagcagagaggcccctttcaaggtgttcgggtaaagaactcagtg
aaggaactcctgttgcacatccgaagtcataaacagaaggcttctggccaagctgtggat
gattttaagacacaaggtgtgaacatagaacagttcagagaattgaagaacacagtatca
tacagtgggaaaaggaaagggcccgattcgttgtctgatggacctgcttgcaaaaggcca
gctctgttgcattcccaatttttgacaccacctcaaacaccaacgcccggggagagcatg
gaagatgttcatctcaatgaacccaaacaggagagcagtgctgatctgcttcagaacatt
atcaacattaagaatgaatgcagccccgtttccctgaacacagttcaagttagctggctg
aaccccgtggtggtccctcagagctcccccgcagagcagtgtcaggacttccatggaggg
caggtcttttctccacctcagaaatgccaaccattccaagtcaggggctcccaacaaatg
atagaccaggcttccctgtaccagtattctccacagaaccagcatgtagagcagcagcca
cactacacccacaaaccaactctggaatacagtccttttcccatacctccccagtccccc
gcttatgaaccaaacctctttgatggtccagaatcacagttttgcccaaaccaaagctta
gtttcccttcttggtgatcaaagggaatctgagaatattgctaatcccatgcagacttcc
tccagtgttcagcagcaaaatgatgctcacttgcacagcttcagcatgatgcccagcagc
gcctgtgaggccatggtggggcacgagatggcctctgactcttcaaacacttcactgcca
ttctcaaacatgggaaatccaatgaacaccacacagttagggaaatcactttttcagtgg
caggtggagcaggaagaaagcaaattggcaaatatttcccaagaccagtttctttcaaag
gatgcagatggtgacacgttccttcatattgctgttgcccaagggagaagggcactttcc
tatgttcttgcaagaaagatgaatgcacttcacatgctggatattaaagagcacaatgga
cagagtgcctttcaggtggcagtggctgccaatcagcatctcattgtgcaggatctggtg
aacatcggggcacaggtgaacaccacagactgctggggaagaacacctctgcatgtgtgt
gctgagaagggccactcccaggtgcttcaggcgattcagaagggagcagtgggaagtaat
cagtttgtggatcttgaggcaactaactatgatggcctgactccccttcactgtgcagtc
atagcccacaatgctgtggtccatgaactccagagaaatcaacagcctcattcacctgaa
gttcaggagcttttactgaagaataagagtctggttgataccattaagtgcctaattcaa
atgggagcagcggtggaagcgaaggatcgcaaaagtggccgcacagccctgcatttggca
gctgaagaagcaaatctggaactcattcgcctctttttggagctgcccagttgcctgtct
tttgtgaatgcaaaggcttacaatggcaacactgccctccatgttgctgccagcttgcag
tatcggttgacacaattagatgctgtccgcctgttgatgaggaagggagcagacccaagt
actcggaacttggagaacgaacagccagtgcatttggttcccgatggccctgtgggagaa
cagatccgacgtatcctgaagggaaagtccattcagcagagagctccaccgtattag

DBGET integrated database retrieval system