KEGG   Homo sapiens (human): 64343Help
Entry
64343             CDS       T01001                                 

Gene name
AZI2, AZ2, NAP1, TILP
Definition
5-azacytidine induced 2
Orthology
K12651  
5-azacytidine-induced protein 2
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p24.1
AA seq 243 aa AA seqDB search
MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENS
LLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSES
LKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMR
KECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISRQSICSTAWSAVAQSWDSMNFEDCS
LFA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggatgcactggtagaagatgatatctgtattctgaatcatgaaaaagcccataagaga
gatacagtgactccagtttcaatatattcaggagatgaatctgttgcttcccattttgct
cttgtcactgcatatgaagacatcaaaaaacgacttaaggattcagagaaagagaactct
ttgttaaagaagagaataagatttttggaagaaaagctaatagctcgatttgaagaagaa
acaagttccgtgggacgagaacaagtaaataaggcctatcatgcatatcgagaggtttgc
attgatagagataatttgaagagcaaactggacaaaatgaataaagacaactctgaatct
ttgaaagtattgaatgagcagctacaatctaaagaagtagaactcctccagctgaggaca
gaggtggaaactcagcaggtgatgaggaatttaaatccaccttcatcaaactgggaggtg
gaaaagttgagctgtgacctgaagatccatggtttggaacaagagctggaactgatgagg
aaagaatgtagcgatctcaaaatagaactacagaaagccaaacaaacggatccatatcag
gaagacaatctgaagagcagagatctccaaaaactaagcatttcaagacagagtatctgt
agcacagcctggagtgcagtggcgcaatcatgggatagcatgaattttgaggactgttcc
ctcttcgcataa

DBGET integrated database retrieval system