KEGG   Homo sapiens (human): 64343Help
Entry
64343             CDS       T01001                                 

Gene name
AZI2, AZ2, NAP1, TILP
Definition
(RefSeq) 5-azacytidine induced 2
  KO
K12651  
5-azacytidine-induced protein 2
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    64343 (AZI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.1
AA seq 392 aa AA seqDB search
MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENS
LLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSES
LKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMR
KECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQ
AELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTATYTRHPPLLPNGKALCHTTS
SPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWVFPSPPKSSET
AFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatgcactggtagaagatgatatctgtattctgaatcatgaaaaagcccataagaga
gatacagtgactccagtttcaatatattcaggagatgaatctgttgcttcccattttgct
cttgtcactgcatatgaagacatcaaaaaacgacttaaggattcagagaaagagaactct
ttgttaaagaagagaataagatttttggaagaaaagctaatagctcgatttgaagaagaa
acaagttccgtgggacgagaacaagtaaataaggcctatcatgcatatcgagaggtttgc
attgatagagataatttgaagagcaaactggacaaaatgaataaagacaactctgaatct
ttgaaagtattgaatgagcagctacaatctaaagaagtagaactcctccagctgaggaca
gaggtggaaactcagcaggtgatgaggaatttaaatccaccttcatcaaactgggaggtg
gaaaagttgagctgtgacctgaagatccatggtttggaacaagagctggaactgatgagg
aaagaatgtagcgatctcaaaatagaactacagaaagccaaacaaacggatccatatcag
gaagacaatctgaagagcagagatctccaaaaactaagcatttcaagtgataatatgcag
catgcatactgggaactgaagagagaaatgtctaatttacatctggtgactcaagtacaa
gctgaactactaagaaaactgaaaacctcaactgcaatcaagaaagcctgtgcccctgta
ggatgcagtgaagaccttggaagagacagcacaaaactgcacttgatgaattttactgca
acatacacaagacatccccctctcttaccaaatggcaaagctctttgtcataccacatct
tcccctttaccaggagatgtaaaggttttatcagagaaagcaatcctccaatcatggaca
gacaatgagagatccattcctaatgatggtacatgctttcaggaacacagttcttatggc
agaaattctctggaagacaattcctgggtatttccaagtcctcctaaatcaagtgagaca
gcatttggggaaactaaaactaaaactttgcctttacccaaccttccaccactgcattac
ttggatcaacataatcagaactgcctttataagaattaa

DBGET integrated database retrieval system