KEGG   Homo sapiens (human): 64374Help
Entry
64374             CDS       T01001                                 

Gene name
SIL1, BAP, MSS, ULG5
Definition
(RefSeq) SIL1 nucleotide exchange factor
  KO
K14001  
nucleotide exchange factor SIL1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Disease
H01284  
Marinesco-Sjogren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    64374 (SIL1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    64374 (SIL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H173(Tbio)
UniProt: 
Position
5q31.2
AA seq 461 aa AA seqDB search
MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEE
ELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLD
INTNTYTSQDLKSALAKFKEGAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIET
DMQIMVRLINKFNSSSSSLEEKIAALFDLEYYVHQMDNAQDLLSFGGLQVVINGLNSTEP
LVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATEQPLTAKKKVLFALCSLLRHF
PYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEAELTQEMSPEK
LQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR
TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggctccccagagcctgccttcatctaggatggctcctctgggcatgctgcttgggctg
ctgatggccgcctgcttcaccttctgcctcagtcatcagaacctgaaggagtttgccctg
accaacccagagaagagcagcaccaaagaaacagagagaaaagaaaccaaagccgaggag
gagctggatgccgaagtcctggaggtgttccacccgacgcatgagtggcaggcccttcag
ccagggcaggctgtccctgcaggatcccacgtacggctgaatcttcagactggggaaaga
gaggcaaaactccaatatgaggacaagttccgaaataatttgaaaggcaaaaggctggat
atcaacaccaacacctacacatctcaggatctcaagagtgcactggcaaaattcaaggag
ggggcagagatggagagttcaaaggaagacaaggcaaggcaggctgaggtaaagcggctc
ttccgccccattgaggaactgaagaaagactttgatgagctgaatgttgtcattgagact
gacatgcagatcatggtacggctgatcaacaagttcaatagttccagctccagtttggaa
gagaagattgctgcgctctttgatcttgaatattatgtccatcagatggacaatgcgcag
gacctgctttcctttggtggtcttcaagtggtgatcaatgggctgaacagcacagagccc
ctcgtgaaggagtatgctgcgtttgtgctgggcgctgccttttccagcaaccccaaggtc
caggtggaggccatcgaagggggagccctgcagaagctgctggtcatcctggccacggag
cagccgctcactgcaaagaagaaggtcctgtttgcactgtgctccctgctgcgccacttc
ccctatgcccagcggcagttcctgaagctcggggggctgcaggtcctgaggaccctggtg
caggagaagggcacggaggtgctcgccgtgcgcgtggtcacactgctctacgacctggtc
acggagaagatgttcgccgaggaggaggctgagctgacccaggagatgtccccagagaag
ctgcagcagtatcgccaggtacacctcctgccaggcctgtgggaacagggctggtgcgag
atcacggcccacctcctggcgctgcccgagcatgatgcccgtgagaaggtgctgcagaca
ctgggcgtcctcctgaccacctgccgggaccgctaccgtcaggacccccagctcggcagg
acactggccagcctgcaggctgagtaccaggtgctggccagcctggagctgcaggatggt
gaggacgagggctacttccaggagctgctgggctctgtcaacagcttgctgaaggagctg
agatga

DBGET integrated database retrieval system