KEGG   Homo sapiens (human): 643802Help
Entry
643802            CDS       T01001                                 

Definition
(RefSeq) u3 small nucleolar ribonucleoprotein protein MPP10-like
  KO
K14559  
U3 small nucleolar RNA-associated protein MPP10
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    643802
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     643802
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    643802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
16q12.2
AA seq 143 aa AA seqDB search
MGGDNPEVGKKARNSSKFELRKSPVFSDEDSDLDFDISKLEQQSKVQNTGHGKPREKSII
DEKFFQLSEMEAYLENREKEEERKDDNDDESGKSSRNVNNKDFFDPVESDEDIASDHDDE
LGSNKMMKLLKKKQKKEAFLKYE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgacaatcctgaagtgggcaagaaagctagaaactcaagcaaatttgagctg
aggaaaagcccagttttcagtgatgaggattctgaccttgactttgatatcagcaaattg
gaacagcagagcaaggtgcaaaacacaggacatggaaaaccaagagaaaagtccataata
gacgagaaattcttccaactctctgaaatggaggcttatttagaaaacagagaaaaagaa
gaggaacgaaaagatgataatgatgatgagtcaggtaaaagttccagaaatgtgaacaac
aaagatttttttgatccagttgaaagtgatgaagacatagcaagtgatcatgatgatgag
ctgggttcaaacaagatgatgaaattgctgaagaagaagcagaagaaggaagcatttctg
aaatatgaatga

DBGET integrated database retrieval system