KEGG   Homo sapiens (human): 6439Help
Entry
6439              CDS       T01001                                 

Gene name
SFTPB, PSP-B, SFTB3, SFTP3, SMDP1, SP-B
Definition
surfactant protein B
Organism
hsa  Homo sapiens (human)
Disease
H00217  
Pulmonary surfactant metabolism dysfunction (SMDP)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p12-p11.2
AA seq 393 aa AA seqDB search
MHQAGYPGCRGAMAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQ
CRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLL
MPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPL
PDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALA
VAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSP
TGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLT
LVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaagcagggtacccaggctgcagaggtgccatggctgagtcacacctgctgcag
tggctgctgctgctgctgcccacgctctgtggcccaggcactgctgcctggaccacctca
tccttggcctgtgcccagggccctgagttctggtgccaaagcctggagcaagcattgcag
tgcagagccctagggcattgcctacaggaagtctggggacatgtgggagccgatgaccta
tgccaagagtgtgaggacatcgtccacatccttaacaagatggccaaggaggccattttc
caggacacgatgaggaagttcctggagcaggagtgcaacgtcctccccttgaagctgctc
atgccccagtgcaaccaagtgcttgacgactacttccccctggtcatcgactacttccag
aaccagactgactcaaacggcatctgtatgcacctgggcctgtgcaaatcccggcagcca
gagccagagcaggagccagggatgtcagaccccctgcccaaacctctgcgggaccctctg
ccagaccctctgctggacaagctcgtcctccctgtgctgcccggggccctccaggcgagg
cctgggcctcacacacaggatctctccgagcagcaattccccattcctctcccctattgc
tggctctgcagggctctgatcaagcggatccaagccatgattcccaagggtgcgctagct
gtggcagtggcccaggtgtgccgcgtggtacctctggtggcgggcggcatctgccagtgc
ctggctgagcgctactccgtcatcctgctcgacacgctgctgggccgcatgctgccccag
ctggtctgccgcctcgtcctccggtgctccatggatgacagcgctggcccaaggtcgccg
acaggagaatggctgccgcgagactctgagtgccacctctgcatgtccgtgaccacccag
gccgggaacagcagcgagcaggccataccacaggcaatgctccaggcctgtgttggctcc
tggctggacagggaaaagtgcaagcaatttgtggagcagcacacgccccagctgctgacc
ctggtgcccaggggctgggatgcccacaccacctgccaggccctcggggtgtgtgggacc
atgtccagccctctccagtgtatccacagccccgacctttga

DBGET integrated database retrieval system