KEGG   Homo sapiens (human): 64393Help
Entry
64393             CDS       T01001                                 

Gene name
ZMAT3, PAG608, WIG-1, WIG1
Definition
zinc finger, matrin-type 3
Orthology
K10137  
zinc finger, matrin type 3
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    64393 (ZMAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.32
AA seq 289 aa AA seqDB search
MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQD
CALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPA
ATPVVPVPPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSESSELGQRRARKEGNEFKMMPNRRNMYTVQNNSAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcttgcaacacgccgtgcttcctccacctaagcagccctcaccctcgcctcct
atgtcagtggccaccaggtctacaggaaccttgcagcttccaccacagaagccttttggg
caggaggcttccttgcctcttgcaggggaagaagagttatcgaagggaggggagcaagac
tgtgccctggaggagctatgtaagcccctgtactgcaaactctgcaatgtcaccttgaac
tctgcacagcaagcccaggctcattatcagggtaaaaatcatggtaagaaactccgaaat
tactatgcagcaaatagctgtcctcctcctgctagaatgagcaatgtggtcgagcctgca
gctactccagttgttccagtccctccgcagatgggctcctttaagccaggaggccgagtg
atcctggccacggagaatgattactgtaagctctgtgatgcctccttcagttccccagct
gtggctcaggctcactatcaagggaagaatcatgccaagaggctgcggctggcggaagct
cagagtaactcattctcggaatcctcagagctgggtcaacggcgggccaggaaagaaggg
aatgagtttaagatgatgcctaacaggagaaatatgtatacagtacagaataattcagca
ggtccttacttcaatccccgctctcggcagagaattccacgtgatctggccatgtgtgtt
actccaagtggccagttttactgctcaatgtgtaatgttggagctggcgaagagatggaa
ttccggcagcatttagagagcaagcaacataagagcaaggtgtctgaacagcggtacagg
aatgagatggagaatctgggatatgtatag

DBGET integrated database retrieval system