KEGG   Homo sapiens (human): 64398Help
Entry
64398             CDS       T01001                                 

Gene name
MPP5, PALS1
Definition
(RefSeq) membrane palmitoylated protein 5
  KO
K06091  
MAGUK p55 subfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    64398 (MPP5)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    64398 (MPP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8N3R9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.3
AA seq 675 aa AA seqDB search
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVK
ILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPF
PLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDE
RVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcccatatgaatgggcatgttacagaggaatcagacagcgaagtaaaaaat
gttgatcttgcatcaccagaggaacatcagaagcaccgagagatggctgttgactgccct
ggagatttgggcaccaggatgatgccaatacgtcgaagtgcacagttggagcgtattcgg
caacaacaggaggacatgaggcgtaggagagaggaagaagggaaaaagcaagaacttgac
cttaattcttccatgagacttaagaaactagcccaaattcctccaaagaccggaatagat
aaccctatgtttgatacagaggaaggaattgtcttagaaagtcctcattatgctgtgaaa
atattagaaatagaagacttgttttcttcacttaaacatatccaacatactttggtagat
tctcagagccaggaggatatttcactgcttttacaacttgttcaaaataaggatttccag
aatgcatttaagatacacaatgccatcacagtacacatgaacaaggccagtcctccattt
cctcttatctccaacgcacaagatcttgctcaagaggtacaaactgttttgaagccagtt
catcataaggaaggacaagaactaactgctttgctgaatactccacatattcaggcactt
ttactggcccacgataaggttgctgagcaggaaatgcagctagagcccattacagatgag
agagtttatgaaagtattggccagtatggaggagaaactgtaaaaatagttcgtatagaa
aaggctcgtgatattccgttgggtgctacagttcgtaatgaaatggactctgtcatcatt
agccggatagtaaaagggggtgctgcagagaaaagtggtctgttgcatgaaggagatgaa
gttctagagattaatggcattgaaattcgggggaaagatgtcaatgaggtttttgacttg
ttgtctgatatgcatggtactttgacttttgtcctgattcccagtcaacagatcaagccg
cctcctgccaaggaaacagtaatccatgtaaaagctcattttgactatgacccctcagat
gacccttatgttccatgtcgagagttaggtctgtcttttcaaaaaggtgatatacttcat
gtgatcagtcaagaagatccaaactggtggcaggcctacagggaaggggacgaagataat
caacctctagccgggcttgttccagggaaaagctttcagcagcaaagggaagccatgaaa
caaaccatagaagaagataaggagccagaaaaatcaggaaaactgtggtgtgcaaagaag
aataaaaagaagaggaaaaaggttttatataatgccaataaaaatgatgattatgacaac
gaggagatcttaacctatgaggaaatgtcactttatcatcagccagcaaataggaagaga
cctatcatcttgattggtccacagaactgtggccagaatgaattgcgtcagaggctcatg
aacaaagaaaaggaccgctttgcatctgcagttcctcatacaacccggagtaggcgagac
caagaagtagccggtagagattaccactttgtttcgcggcaagcattcgaggcagacata
gcagctggaaagttcattgagcatggtgaatttgagaagaatttgtatggaactagcata
gattctgtacggcaagtgatcaactctggcaaaatatgtcttttaagtcttcgtacacag
tcattgaagactctccggaattcagatttgaaaccatatattatcttcattgcaccccct
tcacaagaaagacttcgggcattattggccaaagaaggcaagaatccaaagcctgaagag
ttgagagaaatcattgagaagacaagagagatggagcagaacaatggccactactttgat
acggcaattgtgaattccgatcttgataaagcctatcaggaattgcttaggttaattaac
aaacttgatactgaacctcagtgggtaccatccacttggctgaggtga

DBGET integrated database retrieval system