KEGG   Homo sapiens (human): 64409Help
Entry
64409             CDS       T01001                                 

Gene name
GALNT17, GALNACT17, GALNT16, GALNT20, GALNTL3, GalNAc-T17, GalNAc-T19, GalNAc-T5L, WBSCR17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    64409 (GALNT17)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     64409 (GALNT17)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   64409 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 64409
NCBI-ProteinID: NP_071924
OMIM: 615137
HGNC: 16347
Ensembl: ENSG00000185274
Vega: OTTHUMG00000129783
Pharos: Q6IS24(Tdark)
UniProt: Q6IS24 Q2L4S5
Position
7q11.22
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtagccggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagatccggccgcgcgccgaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctgtcgctgctggaggacatcgtgtaccggcagctgaatggc
ttatccaaatcccttgggctcattgaaggttatggtgggcggggtaaagggggccttccg
gctactctttccccggctgaagaagaaaaggctaagggaccccatgagaagtatggctac
aattcatacctcagtgaaaaaatttcactggaccgttccattccggattatcgtcccacc
aagtgtaaggagctcaagtactccaaggacctgccccagatatccatcatattcatcttc
gtgaacgaggccctgtcggtgatcctgcggtccgtgcacagtgccgtcaatcacacgccc
acacacctgctgaaggaaatcattctggtggatgacaacagcgacgaagaggagctgaag
gtccccctagaggagtatgtccacaaacgctaccccgggctggtgaaggtggtaagaaat
cagaagagggaaggcctgatccgcgctcgcattgagggctggaaggtggctaccgggcag
gtcactggcttctttgatgcccacgtggaattcaccgctggctgggctgagccggttcta
tcccgcatccaggaaaaccggaagcgtgtgatcctcccctccattgacaacatcaaacag
gacaactttgaggtgcagcggtacgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccaaaagactggtgggacgccggagacccttctctccccatc
aggaccccagccatgataggctgctcgttcgtggtcaacaggaagttcttcggtgaaatt
ggtcttctggatcctggcatggatgtatacggaggagaaaatattgaactgggaatcaag
gtatggctctgtgggggcagcatggaggtccttccttgctcacgggtggcccacattgag
cggaagaagaagccatataatagcaacattggcttctacaccaagaggaatgctcttcgc
gttgctgaggtctggatggacgattacaagtctcatgtgtacatagcgtggaacctgccg
ctggagaatccgggaattgacatcggtgatgtctccgaaagaagagcattaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccatgtttacccagaaatgagaagatac
aataataccgttgcttacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatattgtatccgtgccatggctggggaccacag
cttgcccgctacaccaaggaaggcttcctgcacttgggtgccctggggaccaccacactc
ctccctgacacccgctgcctggtggacaactccaagagtcggctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaatggagccatc
atgaacaagggcacgggacgctgcctggaggtggagaaccggggcctggctggcatcgac
ctcatcctccgcagctgcacaggtcagaggtggaccattaagaactccatcaagtag

DBGET integrated database retrieval system